Clone BO11482 Report

Search the DGRC for BO11482

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG11279-RA
Protein status:BO11482.pep: validated full length
Sequenced Size:340

Clone Sequence Records

BO11482.3prime Sequence

338 bp (337 high quality bases) assembled on 2006-04-19

> BO11482.3prime
ATGGTCTAGAAAGCTTGCTTCCGCGGACTTGGCGGTACTGGCCGCCGCAG
CCGCCTTCGCCTGGGAGGCGTGGTGCTTGGCCACCGCCTCCTGGGCCTTG
CTCAACTGGATGTAGCCCTCGTGGGCGCGGGAGCGCAGTTCGCTCTCCAC
GCTCTTGTTGACCGACTTCGAAATGACGGACTTGATCTTCTGCGTCTCAT
TGAACTTGGCCTTTTTCGCCTGAATGGGCGCATTTGATCGACGGGTGAAA
GCAGCTTGCTTTTGGTTCTTCTTTTTCTGTATCGCTGCTGGTAGCTTGGC
CTTCTTGAATTTTCCCTGTGGCATGTCGACTGATAACT

BO11482.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-PA 309 CG11279-RA 1..306 324..19 1480 99.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:37:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-RC 1880 CG11279-RC 105..410 324..19 1500 99.3 Minus
CG11279-RB 927 CG11279-RB 105..410 324..19 1500 99.3 Minus
CG11279-RA 452 CG11279-RA 71..376 324..19 1500 99.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 04:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13047235..13047449 233..19 1045 99.1 Minus
3L 28110227 3L 13047081..13047171 324..234 455 100 Minus
Blast to na_te.dros performed on 2015-02-12 04:37:28 has no hits.

BO11482.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:53 Download gff for BO11482.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-PA 1..309 18..324 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:07 Download gff for BO11482.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-PA 1..309 18..324 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 23:27:32 Download gff for BO11482.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 65..385 8..330 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:07:18 Download gff for BO11482.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 65..385 8..330 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:07:18 Download gff for BO11482.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 13047075..13047171 234..330 96 -> Minus
3L 13047235..13047458 8..233 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 23:27:32 Download gff for BO11482.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13040175..13040271 234..330 96 -> Minus
arm_3L 13040335..13040558 8..233 97   Minus

BO11482.5prime Sequence

338 bp (337 high quality bases) assembled on 2006-04-19

> BO11482.5prime
GAAGTTATCAGTCGACATGCCACAGGGAAAATTCAAGAAGGCCAAGCTAC
CAGCAGCGATACAGAAAAAGAAGAACCAAAAGCAAGCTGCTTTCACCCGT
CGATCAAATGCGCCCATTCAGGCGAAAAAGGCCAAGTTCAATGAGACGCA
GAAGATCAAGTCCGTCATTTCGAAGTCGGTCAACAAGAGCGTGGAGAGCG
AACTGCGCTCCCGCGCCCACGAGGGCTACATCCAGTTGAGCAAGGCCCAG
GAGGCGGTGGCCAAGCACCACGCCTCCCAGGCGAAGGCGGCTGCGGCGGC
CAGTACCGCCAAGTCCGCGGAAGCAAGCTTTCTAGACC

BO11482.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-PA 309 CG11279-RA 1..306 17..322 1480 99.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-RC 1880 CG11279-RC 105..410 17..322 1500 99.3 Plus
CG11279-RB 927 CG11279-RB 105..410 17..322 1500 99.3 Plus
CG11279-RA 452 CG11279-RA 71..376 17..322 1500 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13047235..13047449 108..322 1045 99.1 Plus
3L 28110227 3L 13047081..13047171 17..107 455 100 Plus
Blast to na_te.dros performed on 2015-02-12 13:08:21 has no hits.

BO11482.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:54 Download gff for BO11482.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-PA 1..309 17..323 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:09 Download gff for BO11482.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-PA 1..309 17..323 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 06:24:45 Download gff for BO11482.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 65..385 11..333 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:37:01 Download gff for BO11482.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 65..385 11..333 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:37:01 Download gff for BO11482.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 13047075..13047171 11..107 96 -> Plus
3L 13047235..13047458 108..333 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 06:24:45 Download gff for BO11482.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13040175..13040271 11..107 96 -> Plus
arm_3L 13040335..13040558 108..333 97   Plus

BO11482.complete Sequence

340 bp assembled on 2006-10-10

GenBank Submission: FJ632097

> BO11482.complete
GAAGTTATCAGTCGACATGCCACAGGGAAAATTCAAGAAGGCCAAGCTAC
CAGCAGCGATACAGAAAAAGAAGAACCAAAAGCAAGCTGCTTTCACCCGT
CGATCAAATGCGCCCATTCAGGCGAAAAAGGCCAAGTTCAATGAGACGCA
GAAGATCAAGTCCGTCATTTCGAAGTCGGTCAACAAGAGCGTGGAGAGCG
AACTGCGCTCCCGCGCCCACGAGGGCTACATCCAGTTGAGCAAGGCCCAG
GAGGCGGTGGCCAAGCACCACGCCTCCCAGGCGAAGGCGGCTGCGGCGGC
CAGTACCGCCAAGTCCGCGGAAGCAAGCTTTCTAGACCAT

BO11482.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 16:34:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-RC 309 CG11279-PC 1..306 17..322 1500 99.3 Plus
CG11279-RB 309 CG11279-PB 1..306 17..322 1500 99.3 Plus
CG11279-RA 309 CG11279-PA 1..306 17..322 1500 99.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-RC 1880 CG11279-RC 105..410 17..322 1500 99.3 Plus
CG11279-RB 927 CG11279-RB 105..410 17..322 1500 99.3 Plus
CG11279-RA 452 CG11279-RA 71..376 17..322 1500 99.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 16:34:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13047235..13047449 108..322 1045 99.1 Plus
3L 28110227 3L 13047081..13047171 17..107 455 100 Plus
Blast to na_te.dros performed on 2014-11-26 16:34:24 has no hits.

BO11482.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:28:25 Download gff for BO11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 1..309 17..323 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:47:45 Download gff for BO11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 52..372 11..333 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:04:20 Download gff for BO11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 71..376 17..324 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:28:26 Download gff for BO11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 52..372 11..333 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:22:20 Download gff for BO11482.complete
Subject Subject Range Query Range Percent Splice Strand
CG11279-RA 71..376 17..324 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 17:22:20 Download gff for BO11482.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13047081..13047171 17..107 100 -> Plus
3L 13047235..13047449 108..324 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:04:20 Download gff for BO11482.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13040181..13040271 17..107 100 -> Plus
arm_3L 13040335..13040549 108..324 98   Plus

BO11482.pep Sequence

Translation from 16 to 340

> BO11482.pep
MPQGKFKKAKLPAAIQKKKNQKQAAFTRRSNAPIQAKKAKFNETQKIKSV
ISKSVNKSVESELRSRAHEGYIQLSKAQEAVAKHHASQAKAAAAASTAKS
AEASFLDH

BO11482.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG11279-PC 102 CG11279-PC 1..102 1..102 492 100 Plus
CG11279-PB 102 CG11279-PB 1..102 1..102 492 100 Plus
CG11279-PA 102 CG11279-PA 1..102 1..102 492 100 Plus