Clone BO11485 Report

Search the DGRC for BO11485

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:85
Vector:pDNR-Dual
Associated Gene/TranscriptRpS28b-RA
Protein status:BO11485.pep: validated full length
Sequenced Size:229

Clone Sequence Records

BO11485.3prime Sequence

227 bp (226 high quality bases) assembled on 2006-04-19

> BO11485.3prime
ATGGTCTAGAAAGCTTGCGCGCAGCCTCCTGGCTTCACGTTCGGATTCCA
AAAGGGTCAGGATGTCGCCCTCGCGAACTGGTCCCTTCACGTTTCGGATA
ATCTGGCGGTTCTGCTCGCCCAGGAACTCGACCTTCACCTGGGTACACTG
ACCCTGGGAGCCGGTGCGGCCCAGAACCTTCATGACGCGTGCCCACACAA
CTGGTTTGTCCATGTCGACTGATAACT

BO11485.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG2998-PA 198 RpS28b-RA 1..195 213..19 975 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 972 CG2998-RB 86..282 215..19 985 100 Minus
RpS28b-RA 520 CG2998-RA 86..282 215..19 985 100 Minus
RpS28a-RA 304 CG15527-RA 93..242 168..19 330 81.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9554708..9554904 215..19 985 100 Minus
3R 32079331 3R 30022407..30022556 19..168 330 81.3 Plus
Blast to na_te.dros performed on 2015-02-12 11:31:56 has no hits.

BO11485.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:58 Download gff for BO11485.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 15..213 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:12 Download gff for BO11485.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 15..213 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 02:11:28 Download gff for BO11485.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..287 11..223 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:36:33 Download gff for BO11485.3prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..287 11..223 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:36:33 Download gff for BO11485.3prime
Subject Subject Range Query Range Percent Splice Strand
X 9554703..9554909 11..223 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 02:11:28 Download gff for BO11485.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9448736..9448942 11..223 96   Minus

BO11485.5prime Sequence

227 bp (226 high quality bases) assembled on 2006-04-19

> BO11485.5prime
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCGCAAGCTTTCTAGACC

BO11485.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG2998-PA 198 RpS28b-RA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 972 CG2998-RB 86..282 15..211 985 100 Plus
RpS28b-RA 520 CG2998-RA 86..282 15..211 985 100 Plus
RpS28a-RA 304 CG15527-RA 93..242 62..211 330 81.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9554708..9554904 15..211 985 100 Plus
3R 32079331 3R 30022407..30022556 211..62 330 81.3 Minus
Blast to na_te.dros performed on 2015-02-13 09:40:49 has no hits.

BO11485.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:59 Download gff for BO11485.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 17..215 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:14 Download gff for BO11485.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2998-PA 1..198 17..215 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 11:45:22 Download gff for BO11485.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..287 7..219 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:24:56 Download gff for BO11485.5prime
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 81..287 7..219 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:24:56 Download gff for BO11485.5prime
Subject Subject Range Query Range Percent Splice Strand
X 9554703..9554909 7..219 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 11:45:22 Download gff for BO11485.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9448736..9448942 7..219 96   Plus

BO11485.complete Sequence

229 bp assembled on 2007-10-17

GenBank Submission: FJ632098

> BO11485.complete
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCGCAAGCTTTCTAGACCAT

BO11485.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:04:54
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 198 CG2998-PB 1..195 17..211 975 100 Plus
RpS28b-RA 198 CG2998-PA 1..195 17..211 975 100 Plus
RpS28a-RA 195 CG15527-PA 43..192 62..211 330 81.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:04:55
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-RB 972 CG2998-RB 86..282 15..211 985 100 Plus
RpS28b-RA 520 CG2998-RA 86..282 15..211 985 100 Plus
RpS28a-RA 304 CG15527-RA 93..242 62..211 330 81.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:04:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9554708..9554904 15..211 985 100 Plus
3R 32079331 3R 30022407..30022556 211..62 330 81.3 Minus
Blast to na_te.dros performed on 2014-11-27 10:04:53 has no hits.

BO11485.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:58:37 Download gff for BO11485.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 1..198 17..215 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:00:57 Download gff for BO11485.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 85..291 7..219 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:49 Download gff for BO11485.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 88..282 17..213 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:41:38 Download gff for BO11485.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 92..286 17..213 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:27 Download gff for BO11485.complete
Subject Subject Range Query Range Percent Splice Strand
RpS28b-RA 88..282 17..213 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:27 Download gff for BO11485.complete
Subject Subject Range Query Range Percent Splice Strand
X 9554710..9554904 17..213 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:49 Download gff for BO11485.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9448743..9448937 17..213 98   Plus

BO11485.pep Sequence

Translation from 16 to 229

> BO11485.pep
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD
ILTLLESEREARRLRASFLDH

BO11485.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
RpS28b-PB 65 CG2998-PB 1..65 1..65 329 100 Plus
RpS28b-PA 65 CG2998-PA 1..65 1..65 329 100 Plus
RpS28a-PA 64 CG15527-PA 1..64 1..65 264 81.5 Plus