Clone Sequence Records
BO11485.3prime Sequence
227 bp (226 high quality bases) assembled on 2006-04-19
> BO11485.3prime
ATGGTCTAGAAAGCTTGCGCGCAGCCTCCTGGCTTCACGTTCGGATTCCA
AAAGGGTCAGGATGTCGCCCTCGCGAACTGGTCCCTTCACGTTTCGGATA
ATCTGGCGGTTCTGCTCGCCCAGGAACTCGACCTTCACCTGGGTACACTG
ACCCTGGGAGCCGGTGCGGCCCAGAACCTTCATGACGCGTGCCCACACAA
CTGGTTTGTCCATGTCGACTGATAACT
BO11485.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2998-PA | 198 | RpS28b-RA | 1..195 | 213..19 | 975 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:31:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 972 | CG2998-RB | 86..282 | 215..19 | 985 | 100 | Minus |
RpS28b-RA | 520 | CG2998-RA | 86..282 | 215..19 | 985 | 100 | Minus |
RpS28a-RA | 304 | CG15527-RA | 93..242 | 168..19 | 330 | 81.3 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:31:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9554708..9554904 | 215..19 | 985 | 100 | Minus |
3R | 32079331 | 3R | 30022407..30022556 | 19..168 | 330 | 81.3 | Plus |
Blast to na_te.dros performed on 2015-02-12 11:31:56 has no hits.
BO11485.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:58 Download gff for
BO11485.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 15..213 | 98 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:12 Download gff for
BO11485.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 15..213 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 02:11:28 Download gff for
BO11485.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..287 | 11..223 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:36:33 Download gff for
BO11485.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..287 | 11..223 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:36:33 Download gff for
BO11485.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9554703..9554909 | 11..223 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 02:11:28 Download gff for
BO11485.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9448736..9448942 | 11..223 | 96 | | Minus |
BO11485.5prime Sequence
227 bp (226 high quality bases) assembled on 2006-04-19
> BO11485.5prime
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCGCAAGCTTTCTAGACC
BO11485.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG2998-PA | 198 | RpS28b-RA | 1..195 | 17..211 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:40:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 972 | CG2998-RB | 86..282 | 15..211 | 985 | 100 | Plus |
RpS28b-RA | 520 | CG2998-RA | 86..282 | 15..211 | 985 | 100 | Plus |
RpS28a-RA | 304 | CG15527-RA | 93..242 | 62..211 | 330 | 81.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:40:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9554708..9554904 | 15..211 | 985 | 100 | Plus |
3R | 32079331 | 3R | 30022407..30022556 | 211..62 | 330 | 81.3 | Minus |
Blast to na_te.dros performed on 2015-02-13 09:40:49 has no hits.
BO11485.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:07:59 Download gff for
BO11485.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 17..215 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:14 Download gff for
BO11485.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG2998-PA | 1..198 | 17..215 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 11:45:22 Download gff for
BO11485.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..287 | 7..219 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:24:56 Download gff for
BO11485.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 81..287 | 7..219 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:24:56 Download gff for
BO11485.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9554703..9554909 | 7..219 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 11:45:22 Download gff for
BO11485.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9448736..9448942 | 7..219 | 96 | | Plus |
BO11485.complete Sequence
229 bp assembled on 2007-10-17
GenBank Submission: FJ632098
> BO11485.complete
GAAGTTATCAGTCGACATGGACAAACCAGTTGTGTGGGCACGCGTCATGA
AGGTTCTGGGCCGCACCGGCTCCCAGGGTCAGTGTACCCAGGTGAAGGTC
GAGTTCCTGGGCGAGCAGAACCGCCAGATTATCCGAAACGTGAAGGGACC
AGTTCGCGAGGGCGACATCCTGACCCTTTTGGAATCCGAACGTGAAGCCA
GGAGGCTGCGCGCAAGCTTTCTAGACCAT
BO11485.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:04:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 198 | CG2998-PB | 1..195 | 17..211 | 975 | 100 | Plus |
RpS28b-RA | 198 | CG2998-PA | 1..195 | 17..211 | 975 | 100 | Plus |
RpS28a-RA | 195 | CG15527-PA | 43..192 | 62..211 | 330 | 81.3 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:04:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-RB | 972 | CG2998-RB | 86..282 | 15..211 | 985 | 100 | Plus |
RpS28b-RA | 520 | CG2998-RA | 86..282 | 15..211 | 985 | 100 | Plus |
RpS28a-RA | 304 | CG15527-RA | 93..242 | 62..211 | 330 | 81.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:04:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 9554708..9554904 | 15..211 | 985 | 100 | Plus |
3R | 32079331 | 3R | 30022407..30022556 | 211..62 | 330 | 81.3 | Minus |
Blast to na_te.dros performed on 2014-11-27 10:04:53 has no hits.
BO11485.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:58:37 Download gff for
BO11485.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 1..198 | 17..215 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:00:57 Download gff for
BO11485.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 85..291 | 7..219 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:49 Download gff for
BO11485.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 88..282 | 17..213 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:41:38 Download gff for
BO11485.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 92..286 | 17..213 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:27 Download gff for
BO11485.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpS28b-RA | 88..282 | 17..213 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:27 Download gff for
BO11485.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 9554710..9554904 | 17..213 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:49 Download gff for
BO11485.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 9448743..9448937 | 17..213 | 98 | | Plus |
BO11485.pep Sequence
Translation from 16 to 229
> BO11485.pep
MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKGPVREGD
ILTLLESEREARRLRASFLDH
BO11485.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:59:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpS28b-PB | 65 | CG2998-PB | 1..65 | 1..65 | 329 | 100 | Plus |
RpS28b-PA | 65 | CG2998-PA | 1..65 | 1..65 | 329 | 100 | Plus |
RpS28a-PA | 64 | CG15527-PA | 1..64 | 1..65 | 264 | 81.5 | Plus |