Clone Sequence Records
BO11489.3prime Sequence
275 bp (274 high quality bases) assembled on 2006-04-19
> BO11489.3prime
ATGGTCTAGAAAGCTTGCGTGCTTGGGAGTGGGCTTCGAAAGCTCAGCCA
AGGCACGGGCCTCAGCCTCTGCGCTGCGCTTCTTCTCCTCGGCGAGCTTG
GCATCACGGACGGCCTTCTGCTGTGCCTCGATCTCGCGCAACTTCTCCTC
CTTCTTGGACAGGCGGCTCTGGTGGGCGGCGCCGTAGGCAATGCCCACCA
GGAGCAGGGACCATCTGCCGAACTTGATCAGCGGGGAAACGCGAACGGGA
GCCTGCGACATGTCGACTGATAACT
BO11489.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-PA | 246 | CG3321-RA | 1..243 | 261..19 | 1215 | 100 | Minus |
CG3321-PB | 246 | CG3321-RB | 1..243 | 261..19 | 1215 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 17:29:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 664 | CG3321-RC | 219..462 | 262..19 | 1220 | 100 | Minus |
CG3321-RB | 599 | CG3321-RB | 154..397 | 262..19 | 1220 | 100 | Minus |
CG3321-RA | 543 | CG3321-RA | 98..341 | 262..19 | 1220 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 17:29:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 14327290..14327533 | 262..19 | 1220 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-03 17:29:38 has no hits.
BO11489.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:08:06 Download gff for
BO11489.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PA | 1..246 | 18..261 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:24 Download gff for
BO11489.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PB | 1..246 | 18..261 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 05:35:27 Download gff for
BO11489.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..341 | 19..262 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 19:02:14 Download gff for
BO11489.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..341 | 19..262 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 19:02:14 Download gff for
BO11489.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14327290..14327533 | 19..262 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 05:35:27 Download gff for
BO11489.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 10153012..10153255 | 19..262 | 100 | | Minus |
BO11489.5prime Sequence
275 bp (274 high quality bases) assembled on 2006-04-19
> BO11489.5prime
GAAGTTATCAGTCGACATGTCGCAGGCTCCCGTTCGCGTTTCCCCGCTGA
TCAAGTTCGGCAGATGGTCCCTGCTCCTGGTGGGCATTGCCTACGGCGCC
GCCCACCAGAGCCGCCTGTCCAAGAAGGAGGAGAAGTTGCGCGAGATCGA
GGCACAGCAGAAGGCCGTCCGTGATGCCAAGCTCGCCGAGGAGAAGAAGC
GCAGCGCAGAGGCTGAGGCCCGTGCCTTGGCTGAGCTTTCGAAGCCCACT
CCCAAGCACGCAAGCTTTCTAGACC
BO11489.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-PA | 246 | CG3321-RA | 1..243 | 17..259 | 1215 | 100 | Plus |
CG3321-PB | 246 | CG3321-RB | 1..243 | 17..259 | 1215 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:50:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 664 | CG3321-RC | 219..462 | 16..259 | 1220 | 100 | Plus |
CG3321-RB | 599 | CG3321-RB | 154..397 | 16..259 | 1220 | 100 | Plus |
CG3321-RA | 543 | CG3321-RA | 98..341 | 16..259 | 1220 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:50:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 14327290..14327533 | 16..259 | 1220 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 10:50:30 has no hits.
BO11489.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:08:07 Download gff for
BO11489.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PA | 1..246 | 17..260 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:25 Download gff for
BO11489.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-PB | 1..246 | 17..260 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:38:39 Download gff for
BO11489.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..341 | 16..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:25:53 Download gff for
BO11489.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 98..341 | 16..259 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:25:53 Download gff for
BO11489.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14327290..14327533 | 16..259 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:38:39 Download gff for
BO11489.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 10153012..10153255 | 16..259 | 100 | | Plus |
BO11489.complete Sequence
277 bp assembled on 2006-10-10
GenBank Submission: FJ632100
> BO11489.complete
GAAGTTATCAGTCGACATGTCGCAGGCTCCCGTTCGCGTTTCCCCGCTGA
TCAAGTTCGGCAGATGGTCCCTGCTCCTGGTGGGCATTGCCTACGGCGCC
GCCCACCAGAGCCGCCTGTCCAAGAAGGAGGAGAAGTTGCGCGAGATCGA
GGCACAGCAGAAGGCCGTCCGTGATGCCAAGCTCGCCGAGGAGAAGAAGC
GCAGCGCAGAGGCTGAGGCCCGTGCCTTGGCTGAGCTTTCGAAGCCCACT
CCCAAGCACGCAAGCTTTCTAGACCAT
BO11489.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:45:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 246 | CG3321-PC | 1..243 | 17..259 | 1215 | 100 | Plus |
CG3321-RB | 246 | CG3321-PB | 1..243 | 17..259 | 1215 | 100 | Plus |
CG3321-RA | 246 | CG3321-PA | 1..243 | 17..259 | 1215 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:45:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-RC | 664 | CG3321-RC | 219..462 | 16..259 | 1220 | 100 | Plus |
CG3321-RB | 599 | CG3321-RB | 154..397 | 16..259 | 1220 | 100 | Plus |
CG3321-RA | 543 | CG3321-RA | 98..341 | 16..259 | 1220 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:45:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 14327290..14327533 | 16..259 | 1220 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 14:45:11 has no hits.
BO11489.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:30:09 Download gff for
BO11489.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RB | 1..246 | 17..260 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:48:27 Download gff for
BO11489.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RB | 198..441 | 16..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:52 Download gff for
BO11489.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 99..341 | 17..261 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:30:09 Download gff for
BO11489.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RB | 198..441 | 16..259 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:01 Download gff for
BO11489.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3321-RA | 99..341 | 17..261 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:52:01 Download gff for
BO11489.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 14327291..14327533 | 17..261 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:52 Download gff for
BO11489.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 10153013..10153255 | 17..261 | 99 | | Plus |
BO11489.pep Sequence
Translation from 16 to 277
> BO11489.pep
MSQAPVRVSPLIKFGRWSLLLVGIAYGAAHQSRLSKKEEKLREIEAQQKA
VRDAKLAEEKKRSAEAEARALAELSKPTPKHASFLDH
BO11489.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:49:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3321-PC | 81 | CG3321-PC | 1..81 | 1..81 | 396 | 100 | Plus |
CG3321-PB | 81 | CG3321-PB | 1..81 | 1..81 | 396 | 100 | Plus |
CG3321-PA | 81 | CG3321-PA | 1..81 | 1..81 | 396 | 100 | Plus |