Clone BO11496 Report

Search the DGRC for BO11496

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:114
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptCdlc2-RA
Protein status:BO11496.pep: validated full length
Sequenced Size:301

Clone Sequence Records

BO11496.3prime Sequence

299 bp (298 high quality bases) assembled on 2006-04-19

> BO11496.3prime
ATGGTCTAGAAAGCTTGCACCGCTCTTGAAGAGCAGAATGGCCACCTGGC
CCAGGTAGAAATAGATGAAGTGGCGCGTCTCGTGGGTCACATAGGATCCG
AAGTTGCGGCCCACGATGCAGTGCCAGGTGGGGTTGTACTTCTTGTCGAA
CTCCTTCTTGATGAAGGCGGCGATGTCCTTCTCGATGTTGTACTTCTCCA
GGGCCTGGGTGGCGCAGTCAACAGCGTCCTGCTGCATCTCCTCGCTCATG
TCAGCGTTCTTGATCACCGCCTTGCGATCCGACATGTCGACTGATAACT

BO11496.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG5450-PA 270 Cdlc2-RA 1..267 285..19 1335 100 Minus
CG5450-PB 270 Cdlc2-RB 1..267 285..19 1335 100 Minus
CG6998-PB 270 ctp-RB 79..218 207..68 250 87.1 Minus
CG6998-PD 270 ctp-RD 79..218 207..68 250 87.1 Minus
CG6998-PA 270 ctp-RA 79..218 207..68 250 87.1 Minus
CG6998-PC 270 ctp-RC 79..218 207..68 250 87.1 Minus
CG6998-PB 270 ctp-RB 1..59 285..227 145 89.8 Minus
CG6998-PD 270 ctp-RD 1..59 285..227 145 89.8 Minus
CG6998-PA 270 ctp-RA 1..59 285..227 145 89.8 Minus
CG6998-PC 270 ctp-RC 1..59 285..227 145 89.8 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 671 CG5450-RC 152..418 285..19 1335 100 Minus
Cdlc2-RB 621 CG5450-RB 102..368 285..19 1335 100 Minus
Cdlc2-RA 675 CG5450-RA 156..422 285..19 1335 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344616..1344882 285..19 1335 100 Minus
X 23542271 X 4698295..4698455 179..19 430 84.5 Minus
X 23542271 X 4691737..4691845 285..177 305 85.3 Minus
Blast to na_te.dros performed on 2015-02-12 00:58:07 has no hits.

BO11496.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:08:19 Download gff for BO11496.3prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-PA 1..270 15..285 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:44 Download gff for BO11496.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5450-PA 1..270 15..285 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 15:54:51 Download gff for BO11496.3prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..425 15..295 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:39:41 Download gff for BO11496.3prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..425 15..295 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 04:39:41 Download gff for BO11496.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 1344605..1344885 15..295 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 15:54:51 Download gff for BO11496.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1344605..1344885 15..295 97   Minus

BO11496.5prime Sequence

299 bp (298 high quality bases) assembled on 2006-04-19

> BO11496.5prime
GAAGTTATCAGTCGACATGTCGGATCGCAAGGCGGTGATCAAGAACGCTG
ACATGAGCGAGGAGATGCAGCAGGACGCTGTTGACTGCGCCACCCAGGCC
CTGGAGAAGTACAACATCGAGAAGGACATCGCCGCCTTCATCAAGAAGGA
GTTCGACAAGAAGTACAACCCCACCTGGCACTGCATCGTGGGCCGCAACT
TCGGATCCTATGTGACCCACGAGACGCGCCACTTCATCTATTTCTACCTG
GGCCAGGTGGCCATTCTGCTCTTCAAGAGCGGTGCAAGCTTTCTAGACC

BO11496.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5450-PA 270 Cdlc2-RA 1..267 17..283 1335 100 Plus
CG5450-PB 270 Cdlc2-RB 1..267 17..283 1335 100 Plus
CG6998-PB 270 ctp-RB 79..218 95..234 250 87.1 Plus
CG6998-PD 270 ctp-RD 79..218 95..234 250 87.1 Plus
CG6998-PA 270 ctp-RA 79..218 95..234 250 87.1 Plus
CG6998-PC 270 ctp-RC 79..218 95..234 250 87.1 Plus
CG6998-PB 270 ctp-RB 1..59 17..75 145 89.8 Plus
CG6998-PD 270 ctp-RD 1..59 17..75 145 89.8 Plus
CG6998-PA 270 ctp-RA 1..59 17..75 145 89.8 Plus
CG6998-PC 270 ctp-RC 1..59 17..75 145 89.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:08:05
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 671 CG5450-RC 152..418 17..283 1335 100 Plus
Cdlc2-RB 621 CG5450-RB 102..368 17..283 1335 100 Plus
Cdlc2-RA 675 CG5450-RA 156..422 17..283 1335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344616..1344882 17..283 1335 100 Plus
X 23542271 X 4698295..4698455 123..283 430 84.5 Plus
X 23542271 X 4691737..4691845 17..125 305 85.3 Plus
Blast to na_te.dros performed on 2015-02-12 13:08:02 has no hits.

BO11496.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:08:20 Download gff for BO11496.5prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-PA 1..270 17..287 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:32:46 Download gff for BO11496.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5450-PA 1..270 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 06:24:43 Download gff for BO11496.5prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..425 7..287 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 14:34:27 Download gff for BO11496.5prime
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 145..425 7..287 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 14:34:27 Download gff for BO11496.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 1344605..1344885 7..287 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 06:24:43 Download gff for BO11496.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1344605..1344885 7..287 97   Plus

BO11496.complete Sequence

301 bp assembled on 2006-10-10

GenBank Submission: FJ632103

> BO11496.complete
GAAGTTATCAGTCGACATGTCGGATCGCAAGGCGGTGATCAAGAACGCTG
ACATGAGCGAGGAGATGCAGCAGGACGCTGTTGACTGCGCCACCCAGGCC
CTGGAGAAGTACAACATCGAGAAGGACATCGCCGCCTTCATCAAGAAGGA
GTTCGACAAGAAGTACAACCCCACCTGGCACTGCATCGTGGGCCGCAACT
TCGGATCCTATGTGACCCACGAGACGCGCCACTTCATCTATTTCTACCTG
GGCCAGGTGGCCATTCTGCTCTTCAAGAGCGGTGCAAGCTTTCTAGACCA
T

BO11496.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:08:30
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 270 CG5450-PC 1..267 17..283 1335 100 Plus
Cdlc2-RB 270 CG5450-PB 1..267 17..283 1335 100 Plus
Cdlc2-RA 270 CG5450-PA 1..267 17..283 1335 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:08:32
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-RC 671 CG5450-RC 152..418 17..283 1335 100 Plus
Cdlc2-RB 621 CG5450-RB 102..368 17..283 1335 100 Plus
Cdlc2-RA 675 CG5450-RA 156..422 17..283 1335 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:08:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1344616..1344882 17..283 1335 100 Plus
X 23542271 X 4698295..4698455 123..283 430 84.5 Plus
X 23542271 X 4691737..4691845 17..125 305 85.3 Plus
Blast to na_te.dros performed on 2014-11-27 02:08:28 has no hits.

BO11496.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:31:29 Download gff for BO11496.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RB 1..270 17..287 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:49:27 Download gff for BO11496.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 126..406 7..287 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:10:26 Download gff for BO11496.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 156..422 17..285 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:31:29 Download gff for BO11496.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 126..406 7..287 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:38:15 Download gff for BO11496.complete
Subject Subject Range Query Range Percent Splice Strand
Cdlc2-RA 156..422 17..285 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:38:15 Download gff for BO11496.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1344616..1344882 17..285 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:10:26 Download gff for BO11496.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1344616..1344882 17..285 99   Plus

BO11496.pep Sequence

Translation from 16 to 301

> BO11496.pep
MSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKY
NPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSGASFLDH

BO11496.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:55:05
Subject Length Description Subject Range Query Range Score Percent Strand
Cdlc2-PC 89 CG5450-PC 1..89 1..89 472 100 Plus
Cdlc2-PB 89 CG5450-PB 1..89 1..89 472 100 Plus
Cdlc2-PA 89 CG5450-PA 1..89 1..89 472 100 Plus
ctp-PE 89 CG6998-PE 1..89 1..89 469 98.9 Plus
ctp-PC 89 CG6998-PC 1..89 1..89 469 98.9 Plus