Clone BO11566 Report

Search the DGRC for BO11566

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:115
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptmRpL33-RA
Protein status:BO11566.pep: validated full length
Sequenced Size:226

Clone Sequence Records

BO11566.5prime Sequence

224 bp (223 high quality bases) assembled on 2006-04-19

> BO11566.5prime
GAAGTTATCAGTCGACATGCGTCTAACTAACGTTTTGTTCAAAAAGGTGA
AGAGCAAGCGCATCATGGTCGTACTGGAAAGTGTGGTCAGTGGACATCAG
TTTAATGCTTTTCGCGATCGCTTGGCCGACAAATTGGAGATAATACGCTT
CGATCCGTACATTCAACAGGAAAGCCTTTATCGTGAACGCAAGAAAATCC
GCAGCGCCGCAAGCTTTCTAGACC

BO11566.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:25:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG3712-PA 195 mRpL33-RA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 349 CG3712-RA 101..292 17..208 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 19:58:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4321931..4322034 161..58 520 100 Minus
X 23542271 X 4321821..4321867 208..162 235 100 Minus
X 23542271 X 4322090..4322131 58..17 210 100 Minus
Blast to na_te.dros performed on 2015-02-12 19:58:20 has no hits.

BO11566.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:10 Download gff for BO11566.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 17..212 98   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:15 Download gff for BO11566.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 17..212 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 11:51:20 Download gff for BO11566.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..296 5..213 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:16:38 Download gff for BO11566.5prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..296 5..213 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 01:16:38 Download gff for BO11566.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4321817..4321867 162..213 96 <- Minus
X 4321931..4322034 58..161 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 11:51:20 Download gff for BO11566.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4215850..4215900 162..213 96 <- Minus
arm_X 4215964..4216067 58..161 100 <- Minus

BO11566.3prime Sequence

224 bp (223 high quality bases) assembled on 2006-04-19

> BO11566.3prime
ATGGTCTAGAAAGCTTGCGGCGCTGCGGATTTTCTTGCGTTCACGATAAA
GGCTTTCCTGTTGAATGTACGGATCGAAGCGTATTATCTCCAATTTGTCG
GCCAAGCGATCGCGAAAAGCATTAAACTGATGTCCACTGACCACACTTTC
CAGTACGACCATGATGCGCTTGCTCTTCACCTTTTTGAACAAAACGTTAG
TTAGACGCATGTCGACTGATAACT

BO11566.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG3712-PA 195 mRpL33-RA 1..192 210..19 960 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 349 CG3712-RA 101..292 210..19 960 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4321931..4322034 66..169 520 100 Plus
X 23542271 X 4321821..4321867 19..65 235 100 Plus
X 23542271 X 4322090..4322131 169..210 210 100 Plus
Blast to na_te.dros performed on 2015-02-13 09:31:00 has no hits.

BO11566.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:09 Download gff for BO11566.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 15..210 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:13 Download gff for BO11566.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3712-PA 1..195 15..210 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 15:55:43 Download gff for BO11566.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..296 14..222 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:04:19 Download gff for BO11566.3prime
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 88..296 14..222 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:04:19 Download gff for BO11566.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4321817..4321867 14..65 96 <- Plus
X 4321931..4322034 66..169 100 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 15:55:43 Download gff for BO11566.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4215850..4215900 14..65 96 <- Plus
arm_X 4215964..4216067 66..169 100 <- Plus

BO11566.complete Sequence

226 bp assembled on 2006-10-10

GenBank Submission: FJ632106

> BO11566.complete
GAAGTTATCAGTCGACATGCGTCTAACTAACGTTTTGTTCAAAAAGGTGA
AGAGCAAGCGCATCATGGTCGTACTGGAAAGTGTGGTCAGTGGACATCAG
TTTAATGCTTTTCGCGATCGCTTGGCCGACAAATTGGAGATAATACGCTT
CGATCCGTACATTCAACAGGAAAGCCTTTATCGTGAACGCAAGAAAATCC
GCAGCGCCGCAAGCTTTCTAGACCAT

BO11566.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 195 CG3712-PA 1..192 17..208 960 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-RA 349 CG3712-RA 101..292 17..208 960 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4321931..4322034 161..58 520 100 Minus
X 23542271 X 4321821..4321867 208..162 235 100 Minus
X 23542271 X 4322090..4322131 58..17 210 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:34:33 has no hits.

BO11566.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:50:25 Download gff for BO11566.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 1..195 17..212 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:03:30 Download gff for BO11566.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 58..266 5..213 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:32:28 Download gff for BO11566.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 101..292 17..210 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:50:25 Download gff for BO11566.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 58..266 5..213 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:22:23 Download gff for BO11566.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL33-RA 101..292 17..210 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:22:23 Download gff for BO11566.complete
Subject Subject Range Query Range Percent Splice Strand
X 4321819..4321867 162..210 95 <- Minus
X 4321931..4322034 58..161 100 <- Minus
X 4322091..4322131 17..57 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:32:28 Download gff for BO11566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4215852..4215900 162..210 95 <- Minus
arm_X 4215964..4216067 58..161 100 <- Minus
arm_X 4216124..4216164 17..57 100   Minus

BO11566.pep Sequence

Translation from 16 to 226

> BO11566.pep
MRLTNVLFKKVKSKRIMVVLESVVSGHQFNAFRDRLADKLEIIRFDPYIQ
QESLYRERKKIRSAASFLDH

BO11566.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL33-PA 64 CG3712-PA 1..64 1..64 314 100 Plus