Clone BO11568 Report

Search the DGRC for BO11568

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:115
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG8860-RA
Protein status:BO11568.pep: validated full length
Sequenced Size:238

Clone Sequence Records

BO11568.3prime Sequence

236 bp (235 high quality bases) assembled on 2006-04-19

> BO11568.3prime
ATGGTCTAGAAAGCTTGCGGATCCCACGATGATGTTGTTAATGGGAATGT
GAATCAGCTTGACGAAGAAGCCGATGAAGCCCATGATGGCGAAGCCCACG
GCGGTGGCGATGGCGATTTTCTGGAACTCCTTGCGGTCGGGTTTTGTGCA
GCGCTTCACCAGGCGGATTGAGTCCTTGGCGAAGGCGCGTCCGGGTTCGG
CGAATTTGACAACCTTGTCCATGTCGACTGATAACT

BO11568.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 207 CG8860-RA 1..204 222..19 1020 100 Minus
CG14214-PA 207 CG14214-RA 1..200 222..23 475 89.5 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 420 CG8860-RA 110..313 222..19 1020 100 Minus
Sec61gamma-RC 537 CG14214-RC 26..228 225..23 700 89.7 Minus
Sec61gamma-RB 792 CG14214-RB 158..360 225..23 700 89.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 18:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12179590..12179793 19..222 1020 100 Plus
X 23542271 X 19643884..19644086 225..23 700 89.7 Minus
2R 25286936 2R 20512745..20512877 24..156 200 76.7 Plus
Blast to na_te.dros performed on 2015-02-12 18:49:13 has no hits.

BO11568.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:13 Download gff for BO11568.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 18..222 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:19 Download gff for BO11568.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 18..222 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 04:22:42 Download gff for BO11568.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..321 13..222 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:34:54 Download gff for BO11568.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..321 13..222 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:34:54 Download gff for BO11568.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 12179582..12179791 13..220 98 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 04:22:42 Download gff for BO11568.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8067087..8067296 13..220 98 <- Plus

BO11568.5prime Sequence

236 bp (235 high quality bases) assembled on 2006-04-19

> BO11568.5prime
GAAGTTATCAGTCGACATGGACAAGGTTGTCAAATTCGCCGAACCCGGAC
GCGCCTTCGCCAAGGACTCAATCCGCCTGGTGAAGCGCTGCACAAAACCC
GACCGCAAGGAGTTCCAGAAAATCGCCATCGCCACCGCCGTGGGCTTCGC
CATCATGGGCTTCATCGGCTTCTTCGTCAAGCTGATTCACATTCCCATTA
ACAACATCATCGTGGGATCCGCAAGCTTTCTAGACC

BO11568.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 207 CG8860-RA 1..204 17..220 1020 100 Plus
CG14214-PA 207 CG14214-RA 1..200 17..216 475 89.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 00:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 420 CG8860-RA 110..313 17..220 1020 100 Plus
Sec61gamma-RC 537 CG14214-RC 26..228 14..216 700 89.7 Plus
Sec61gamma-RB 792 CG14214-RB 158..360 14..216 700 89.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 00:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12179590..12179793 220..17 1020 100 Minus
X 23542271 X 19643884..19644086 14..216 700 89.7 Plus
2R 25286936 2R 20512745..20512877 215..83 200 76.7 Minus
Blast to na_te.dros performed on 2015-02-12 00:55:49 has no hits.

BO11568.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:14 Download gff for BO11568.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 17..221 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:20 Download gff for BO11568.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-PA 1..207 17..221 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:17:35 Download gff for BO11568.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..321 17..226 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 04:30:29 Download gff for BO11568.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..321 17..226 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 04:30:29 Download gff for BO11568.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 12179582..12179791 19..226 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:17:35 Download gff for BO11568.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8067087..8067296 19..226 98 <- Minus

BO11568.complete Sequence

238 bp assembled on 2006-10-11

GenBank Submission: FJ632107

> BO11568.complete
GAAGTTATCAGTCGACATGGACAAGGTTGTCAAATTCGCCGAACCCGGAC
GCGCCTTCGCCAAGGACTCAATCCGCCTGGTGAAGCGCTGCACAAAACCC
GACCGCAAGGAGTTCCAGAAAATCGCCATCGCCACCGCCGTGGGCTTCGC
CATCATGGGCTTCATCGGCTTCTTCGTCAAGCTGATTCACATTCCCATTA
ACAACATCATCGTGGGATCCGCAAGCTTTCTAGACCAT

BO11568.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 207 CG8860-PA 1..204 17..220 1020 100 Plus
Sec61gamma-RC 207 CG14214-PC 1..200 17..216 685 89.5 Plus
Sec61gamma-RB 207 CG14214-PB 1..200 17..216 685 89.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-RA 420 CG8860-RA 110..313 17..220 1020 100 Plus
Sec61gamma-RC 537 CG14214-RC 26..228 14..216 700 89.7 Plus
Sec61gamma-RB 792 CG14214-RB 158..360 14..216 700 89.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12179590..12179793 220..17 1020 100 Minus
X 23542271 X 19643884..19644086 14..216 700 89.7 Plus
2R 25286936 2R 20512745..20512877 215..83 200 76.7 Minus
Blast to na_te.dros performed on 2014-11-27 14:31:58 has no hits.

BO11568.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:04:42 Download gff for BO11568.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 1..207 17..221 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:19:12 Download gff for BO11568.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 46..257 17..226 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:43 Download gff for BO11568.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..313 17..222 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:04:43 Download gff for BO11568.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 46..257 17..226 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:46 Download gff for BO11568.complete
Subject Subject Range Query Range Percent Splice Strand
CG8860-RA 110..313 17..222 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:46 Download gff for BO11568.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12179588..12179793 17..222 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:43 Download gff for BO11568.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8067093..8067298 17..222 99   Minus

BO11568.pep Sequence

Translation from 16 to 238

> BO11568.pep
MDKVVKFAEPGRAFAKDSIRLVKRCTKPDRKEFQKIAIATAVGFAIMGFI
GFFVKLIHIPINNIIVGSASFLDH

BO11568.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:22:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8860-PA 68 CG8860-PA 1..68 1..68 343 100 Plus
Sec61gamma-PC 68 CG14214-PC 1..68 1..68 339 98.5 Plus
Sec61gamma-PB 68 CG14214-PB 1..68 1..68 339 98.5 Plus
Sec61gamma-PA 68 CG14214-PA 1..68 1..68 339 98.5 Plus
CG13426-PA 105 CG13426-PA 48..104 10..66 196 64.9 Plus