Clone Sequence Records
BO11578.5prime Sequence
236 bp (235 high quality bases) assembled on 2006-04-19
> BO11578.5prime
GAAGTTATCAGTCGACATGTTCCAAAACAGCGCTGCCCGCCTCCTGGTCC
CCGCTATGCGTAGCGCCATGCAGAGCCGTTGCCAGTCGGTCGTCTCTGGA
CCTCCGACCCAGCGCATCTCCACCGCCGAGAAGGTGATCCTCGGCGGCGG
CATGTGCGCTGCATCCTTGTTCATTCCCGCCTGGGTGCTCTACCACATCC
GGGACTACAAGGGCGACAAGGCAAGCTTTCTAGACC
BO11578.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:25:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG7181-PA | 207 | CG7181-RA | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 17:17:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIII-RA | 406 | CG7181-RA | 94..297 | 17..220 | 1020 | 100 | Plus |
| CoVIII-RB | 513 | CG7181-RB | 94..297 | 17..220 | 1020 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 17:17:06
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 21539243..21539354 | 128..17 | 560 | 100 | Minus |
| 3L | 28110227 | 3L | 21539075..21539167 | 220..128 | 465 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-12 17:17:08 has no hits.
BO11578.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:32 Download gff for
BO11578.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG7181-PA | 1..207 | 17..224 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:45 Download gff for
BO11578.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG7181-PA | 1..207 | 17..224 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 17:28:20 Download gff for
BO11578.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIII-RB | 88..303 | 11..227 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:42:39 Download gff for
BO11578.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIII-RB | 88..303 | 11..227 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 19:42:39 Download gff for
BO11578.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 21539069..21539167 | 128..227 | 97 | <- | Minus |
| 3L | 21539244..21539360 | 11..127 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 17:28:20 Download gff for
BO11578.5prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 21532169..21532267 | 128..227 | 97 | <- | Minus |
| arm_3L | 21532344..21532460 | 11..127 | 97 | | Minus |
BO11578.3prime Sequence
236 bp (235 high quality bases) assembled on 2006-04-19
> BO11578.3prime
ATGGTCTAGAAAGCTTGCCTTGTCGCCCTTGTAGTCCCGGATGTGGTAGA
GCACCCAGGCGGGAATGAACAAGGATGCAGCGCACATGCCGCCGCCGAGG
ATCACCTTCTCGGCGGTGGAGATGCGCTGGGTCGGAGGTCCAGAGACGAC
CGACTGGCAACGGCTCTGCATGGCGCTACGCATAGCGGGGACCAGGAGGC
GGGCAGCGCTGTTTTGGAACATGTCGACTGATAACT
BO11578.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:25:59
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG7181-PA | 207 | CG7181-RA | 1..204 | 222..19 | 1020 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:15:14
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIII-RA | 406 | CG7181-RA | 94..297 | 222..19 | 1020 | 100 | Minus |
| CoVIII-RB | 513 | CG7181-RB | 94..297 | 222..19 | 1020 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:15:09
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 21539243..21539354 | 111..222 | 560 | 100 | Plus |
| 3L | 28110227 | 3L | 21539075..21539167 | 19..111 | 465 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 11:15:12 has no hits.
BO11578.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:31 Download gff for
BO11578.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG7181-PA | 1..207 | 15..222 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:44 Download gff for
BO11578.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG7181-PA | 1..207 | 15..222 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 02:10:28 Download gff for
BO11578.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIII-RB | 88..303 | 12..228 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:26:05 Download gff for
BO11578.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIII-RB | 88..303 | 12..228 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:26:05 Download gff for
BO11578.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 21539069..21539167 | 12..111 | 97 | <- | Plus |
| 3L | 21539244..21539360 | 112..228 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 02:10:28 Download gff for
BO11578.3prime
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 21532169..21532267 | 12..111 | 97 | <- | Plus |
| arm_3L | 21532344..21532460 | 112..228 | 97 | | Plus |
BO11578.complete Sequence
238 bp assembled on 2006-10-11
GenBank Submission: FJ632111
> BO11578.complete
GAAGTTATCAGTCGACATGTTCCAAAACAGCGCTGCCCGCCTCCTGGTCC
CCGCTATGCGTAGCGCCATGCAGAGCCGTTGCCAGTCGGTCGTCTCTGGA
CCTCCGACCCAGCGCATCTCCACCGCCGAGAAGGTGATCCTCGGCGGCGG
CATGTGCGCTGCATCCTTGTTCATTCCCGCCTGGGTGCTCTACCACATCC
GGGACTACAAGGGCGACAAGGCAAGCTTTCTAGACCAT
BO11578.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:59:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIII-RA | 207 | CG7181-PA | 1..204 | 17..220 | 1020 | 100 | Plus |
| CoVIII-RB | 207 | CG7181-PB | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:59:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIII-RA | 406 | CG7181-RA | 94..297 | 17..220 | 1020 | 100 | Plus |
| CoVIII-RB | 513 | CG7181-RB | 94..297 | 17..220 | 1020 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:59:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3L | 28110227 | 3L | 21539243..21539354 | 128..17 | 560 | 100 | Minus |
| 3L | 28110227 | 3L | 21539075..21539167 | 220..128 | 465 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:59:38 has no hits.
BO11578.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:43:36 Download gff for
BO11578.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG7181-RA | 1..207 | 17..224 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:54:56 Download gff for
BO11578.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG7181-RA | 88..303 | 11..227 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:35:56 Download gff for
BO11578.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIII-RB | 99..297 | 22..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:43:36 Download gff for
BO11578.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG7181-RA | 88..303 | 11..227 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:41:56 Download gff for
BO11578.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CoVIII-RB | 99..297 | 22..222 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:41:56 Download gff for
BO11578.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3L | 21539073..21539167 | 128..222 | 97 | <- | Minus |
| 3L | 21539244..21539349 | 22..127 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:35:56 Download gff for
BO11578.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3L | 21532173..21532267 | 128..222 | 97 | <- | Minus |
| arm_3L | 21532344..21532449 | 22..127 | 100 | | Minus |
BO11578.pep Sequence
Translation from 16 to 238
> BO11578.pep
MFQNSAARLLVPAMRSAMQSRCQSVVSGPPTQRISTAEKVILGGGMCAAS
LFIPAWVLYHIRDYKGDKASFLDH
BO11578.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:46:22
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CoVIII-PA | 68 | CG7181-PA | 1..68 | 1..68 | 350 | 100 | Plus |
| CoVIII-PB | 68 | CG7181-PB | 1..68 | 1..68 | 350 | 100 | Plus |
