Clone BO11579 Report

Search the DGRC for BO11579

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:115
Well:79
Vector:pDNR-Dual
Associated Gene/TranscriptCG8369-RA
Protein status:BO11579.pep: validated full length
Sequenced Size:316

Clone Sequence Records

BO11579.3prime Sequence

314 bp (313 high quality bases) assembled on 2006-04-19

> BO11579.3prime
ATGGTCTAGAAAGCTTGCGGACAGGCGAACGCTCACTCCACCGCCGCACT
CGCCCTTGGACTTCTGCTCGAATGGATCGTCGGCATGCTGGCAGTTGTAG
TTGGCCATGACGCACGGGCTGCCAAAGGTGAGGAGGCGCTCCTTGCTGCT
GTTTTTGGCCTTGGCACAAACGGGCTCGTAGACTTCACCGCAGTTGTGCT
GGCAACTGTTGGTGGCCGGCTTCTTGGTGTCCTTGGCCGGAGTAGCCAGG
ACGAATGCCAGCAAGCACAGTGCTAGAAAAGCAAACAGAGCGAAACGCAT
GTCGACTGATAACT

BO11579.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 285 CG8369-RA 1..282 300..19 1410 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 20:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 431 CG8369-RA 91..372 300..19 1410 100 Minus
CG8369-RC 774 CG8369-RC 459..715 275..19 1285 100 Minus
CG8369-RB 479 CG8369-RB 166..420 273..19 1275 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 20:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8822466..8822666 275..75 1005 100 Minus
3R 32079331 3R 8822724..8822779 74..19 280 100 Minus
Blast to na_te.dros performed on 2015-01-31 20:05:15 has no hits.

BO11579.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:33 Download gff for BO11579.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 18..300 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:47 Download gff for BO11579.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 18..300 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-07 11:36:01 Download gff for BO11579.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 78..372 19..314 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 22:48:44 Download gff for BO11579.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 78..372 19..314 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 22:48:44 Download gff for BO11579.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 8822469..8822666 75..272 100 -> Minus
3R 8822724..8822779 19..74 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-07 11:36:01 Download gff for BO11579.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4648191..4648388 75..272 100 -> Minus
arm_3R 4648446..4648501 19..74 100   Minus

BO11579.5prime Sequence

314 bp (313 high quality bases) assembled on 2006-04-19

> BO11579.5prime
GAAGTTATCAGTCGACATGCGTTTCGCTCTGTTTGCTTTTCTAGCACTGT
GCTTGCTGGCATTCGTCCTGGCTACTCCGGCCAAGGACACCAAGAAGCCG
GCCACCAACAGTTGCCAGCACAACTGCGGTGAAGTCTACGAGCCCGTTTG
TGCCAAGGCCAAAAACAGCAGCAAGGAGCGCCTCCTCACCTTTGGCAGCC
CGTGCGTCATGGCCAACTACAACTGCCAGCATGCCGACGATCCATTCGAG
CAGAAGTCCAAGGGCGAGTGCGGCGGTGGAGTGAGCGTTCGCCTGTCCGC
AAGCTTTCTAGACC

BO11579.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:26:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 285 CG8369-RA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 431 CG8369-RA 91..372 17..298 1410 100 Plus
CG8369-RC 774 CG8369-RC 459..715 42..298 1285 100 Plus
CG8369-RB 479 CG8369-RB 166..420 44..298 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8822466..8822666 42..242 1005 100 Plus
3R 32079331 3R 8822724..8822779 243..298 280 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:42:36 has no hits.

BO11579.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:34 Download gff for BO11579.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 17..299 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:35:48 Download gff for BO11579.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-PA 1..285 17..299 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 11:12:50 Download gff for BO11579.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 79..372 5..298 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:31:29 Download gff for BO11579.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 79..372 5..298 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:31:29 Download gff for BO11579.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 8822724..8822779 243..298 100   Plus
3R 8822469..8822666 45..242 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 11:12:50 Download gff for BO11579.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4648191..4648388 45..242 100 -> Plus
arm_3R 4648446..4648501 243..298 100   Plus

BO11579.complete Sequence

316 bp assembled on 2006-10-11

GenBank Submission: FJ632112

> BO11579.complete
GAAGTTATCAGTCGACATGCGTTTCGCTCTGTTTGCTTTTCTAGCACTGT
GCTTGCTGGCATTCGTCCTGGCTACTCCGGCCAAGGACACCAAGAAGCCG
GCCACCAACAGTTGCCAGCACAACTGCGGTGAAGTCTACGAGCCCGTTTG
TGCCAAGGCCAAAAACAGCAGCAAGGAGCGCCTCCTCACCTTTGGCAGCC
CGTGCGTCATGGCCAACTACAACTGCCAGCATGCCGACGATCCATTCGAG
CAGAAGTCCAAGGGCGAGTGCGGCGGTGGAGTGAGCGTTCGCCTGTCCGC
AAGCTTTCTAGACCAT

BO11579.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 285 CG8369-PA 1..282 17..298 1410 100 Plus
CG8369-RC 93 CG8369-PC 1..90 209..298 450 100 Plus
CG8369-RB 93 CG8369-PB 1..90 209..298 450 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:31:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-RA 431 CG8369-RA 91..372 17..298 1410 100 Plus
CG8369-RC 774 CG8369-RC 459..715 42..298 1285 100 Plus
CG8369-RB 479 CG8369-RB 166..420 44..298 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8822466..8822666 42..242 1005 100 Plus
3R 32079331 3R 8822724..8822779 243..298 280 100 Plus
Blast to na_te.dros performed on 2014-11-27 08:31:29 has no hits.

BO11579.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:50:16 Download gff for BO11579.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 1..285 17..299 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:05:26 Download gff for BO11579.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 68..361 5..298 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:11:22 Download gff for BO11579.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 91..372 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:50:16 Download gff for BO11579.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 68..361 5..298 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:21:02 Download gff for BO11579.complete
Subject Subject Range Query Range Percent Splice Strand
CG8369-RA 91..372 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:21:02 Download gff for BO11579.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8822098..8822125 17..44 100 -> Plus
3R 8822469..8822666 45..242 100 -> Plus
3R 8822724..8822779 243..300 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:11:22 Download gff for BO11579.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4647820..4647847 17..44 100 -> Plus
arm_3R 4648191..4648388 45..242 100 -> Plus
arm_3R 4648446..4648501 243..300 96   Plus

BO11579.pep Sequence

Translation from 16 to 316

> BO11579.pep
MRFALFAFLALCLLAFVLATPAKDTKKPATNSCQHNCGEVYEPVCAKAKN
SSKERLLTFGSPCVMANYNCQHADDPFEQKSKGECGGGVSVRLSASFLDH

BO11579.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG8369-PA 94 CG8369-PA 1..94 1..94 505 100 Plus
CG8369-PC 30 CG8369-PC 1..30 65..94 166 100 Plus
CG8369-PB 30 CG8369-PB 1..30 65..94 166 100 Plus