Clone BO11584 Report

Search the DGRC for BO11584

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:115
Well:84
Vector:pDNR-Dual
Associated Gene/TranscriptCG40127-RA
Protein status:BO11584.pep:
Sequenced Size:319

Clone Sequence Records

BO11584.3prime Sequence

317 bp (316 high quality bases) assembled on 2006-04-19

> BO11584.3prime
ATGGTCTAGAAAGCTTGCGTTGGCAGTTACTCTGCTATTCATGTAAAATT
GCTGGGCGGAGAGCAACAAAGTCAAAACATATATACATGCGGCAATCCAG
CAGTTGTAGGCATTCTGATTGTATGCTCTATTTGCAGCTGCATAAAAATC
TTCCAACGAATGGTATTCCTCCTCAAGAGGTAAGTCCTCAATGAGGGCTA
CACTATTTATGTAGAAGAATAGACCCATTAAAACCAATTGGACAATACCC
CAAACAGAGATAATAAGACCACAAAGTGATAGTTTCGGGCCACAGATTTT
CATGTCGACTGATAACT

BO11584.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-PA 288 CG40127-RA 1..285 303..19 1425 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-RA 505 CG40127-RA 114..398 303..19 1425 100 Minus
CG40127-RB 1160 CG40127-RB 114..398 303..19 1425 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4187760..4187880 115..235 605 100 Plus
2R 25286936 2R 4187597..4187696 19..118 500 100 Plus
2R 25286936 2R 4187944..4188014 233..303 355 100 Plus
Blast to na_te.dros performed on 2015-02-10 22:08:37 has no hits.

BO11584.3prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:40:32 Download gff for BO11584.3prime
Subject Subject Range Query Range Percent Splice Strand
CG40127-PA 1..288 15..303 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 19:55:00 Download gff for BO11584.3prime
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 109..407 9..310 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:59:04 Download gff for BO11584.3prime
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 109..407 9..310 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:59:04 Download gff for BO11584.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 4187588..4187692 9..114 96 <- Plus
2R 4187760..4187879 115..234 100 <- Plus
2R 4187946..4188019 235..310 94   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 19:55:00 Download gff for BO11584.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 75093..75197 9..114 96 <- Plus
arm_2R 75265..75384 115..234 100 <- Plus
arm_2R 75451..75524 235..310 94   Plus

BO11584.5prime Sequence

317 bp (316 high quality bases) assembled on 2006-04-19

> BO11584.5prime
GAAGTTATCAGTCGACATGAAAATCTGTGGCCCGAAACTATCACTTTGTG
GTCTTATTATCTCTGTTTGGGGTATTGTCCAATTGGTTTTAATGGGTCTA
TTCTTCTACATAAATAGTGTAGCCCTCATTGAGGACTTACCTCTTGAGGA
GGAATACCATTCGTTGGAAGATTTTTATGCAGCTGCAAATAGAGCATACA
ATCAGAATGCCTACAACTGCTGGATTGCCGCATGTATATATGTTTTGACT
TTGTTGCTCTCCGCCCAGCAATTTTACATGAATAGCAGAGTAACTGCCAA
CGCAAGCTTTCTAGACC

BO11584.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-PA 288 CG40127-RA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 02:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-RA 505 CG40127-RA 114..398 17..301 1425 100 Plus
CG40127-RB 1160 CG40127-RB 114..398 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 02:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4187760..4187880 205..85 605 100 Minus
2R 25286936 2R 4187597..4187696 301..202 500 100 Minus
2R 25286936 2R 4187944..4188014 87..17 355 100 Minus
Blast to na_te.dros performed on 2015-02-11 02:27:13 has no hits.

BO11584.5prime Sim4 Records

Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-11 12:40:33 Download gff for BO11584.5prime
Subject Subject Range Query Range Percent Splice Strand
CG40127-PA 1..288 17..305 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 23:30:38 Download gff for BO11584.5prime
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 109..407 10..311 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 04:55:54 Download gff for BO11584.5prime
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 109..407 10..311 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 04:55:54 Download gff for BO11584.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 4187588..4187692 206..311 96 <- Minus
2R 4187760..4187879 86..205 100 <- Minus
2R 4187946..4188019 10..85 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 23:30:38 Download gff for BO11584.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 75093..75197 206..311 96 <- Minus
arm_2R 75265..75384 86..205 100 <- Minus
arm_2R 75451..75524 10..85 94   Minus

BO11584.complete Sequence

319 bp assembled on 2006-10-11

GenBank Submission: FJ632114

> BO11584.complete
GAAGTTATCAGTCGACATGAAAATCTGTGGCCCGAAACTATCACTTTGTG
GTCTTATTATCTCTGTTTGGGGTATTGTCCAATTGGTTTTAATGGGTCTA
TTCTTCTACATAAATAGTGTAGCCCTCATTGAGGACTTACCTCTTGAGGA
GGAATACCATTCGTTGGAAGATTTTTATGCAGCTGCAAATAGAGCATACA
ATCAGAATGCCTACAACTGCTGGATTGCCGCATGTATATATGTTTTGACT
TTGTTGCTCTCCGCCCAGCAATTTTACATGAATAGCAGAGTAACTGCCAA
CGCAAGCTTTCTAGACCAT

BO11584.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-RA 288 CG40127-PA 1..285 17..301 1425 100 Plus
CG40127-RB 288 CG40127-PB 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:40:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-RA 505 CG40127-RA 114..398 17..301 1425 100 Plus
CG40127-RB 1160 CG40127-RB 114..398 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4187760..4187880 205..85 605 100 Minus
2R 25286936 2R 4187597..4187696 301..202 500 100 Minus
2R 25286936 2R 4187944..4188014 87..17 355 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:40:28 has no hits.

BO11584.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:50:17 Download gff for BO11584.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 1..288 17..305 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:05:28 Download gff for BO11584.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 138..436 10..311 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:52:58 Download gff for BO11584.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 114..398 17..303 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:50:17 Download gff for BO11584.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RA 138..436 10..311 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:23:58 Download gff for BO11584.complete
Subject Subject Range Query Range Percent Splice Strand
CG40127-RB 114..398 17..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:23:58 Download gff for BO11584.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4187595..4187692 206..303 97 <- Minus
2R 4187760..4187879 86..205 100 <- Minus
2R 4187946..4188014 17..85 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:52:58 Download gff for BO11584.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 75100..75197 206..303 97 <- Minus
arm_2R 75265..75384 86..205 100 <- Minus
arm_2R 75451..75519 17..85 100   Minus

BO11584.pep Sequence

Translation from 16 to 319

> BO11584.pep
MKICGPKLSLCGLIISVWGIVQLVLMGLFFYINSVALIEDLPLEEEYHSL
EDFYAAANRAYNQNAYNCWIAACIYVLTLLLSAQQFYMNSRVTANASFLD
H

BO11584.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG40127-PA 95 CG40127-PA 1..95 1..95 497 100 Plus
CG40127-PB 95 CG40127-PB 1..95 1..95 497 100 Plus
CG11269-PA 107 CG11269-PA 3..75 4..76 156 41.1 Plus