Clone BO11588 Report

Search the DGRC for BO11588

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:115
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptLcp3-RA
Protein status:BO11588.pep: validated full length
Sequenced Size:370

Clone Sequence Records

BO11588.5prime Sequence

368 bp (367 high quality bases) assembled on 2006-04-19

> BO11588.5prime
GAAGTTATCAGTCGACATGTTCAAGATCCTGCTTGTCTGTTCTCTCGCCG
CCCTGGTGGCCGCCAACGCTAATGTGGAGGTCAAGGAGCTGGTCAACGAT
GTCCAGCCCGATGGCTTTGTCAGCAAGTTGGTCCTCGACGACGGATCTGC
CTCCTCCGCCACCGGAGACATCCACGGCAACATCGACGGAGTCTTCGAGT
GGATCTCCCCCGAGGGTGTCCATGTGCGAGTGAGCTACAAGGCTGACGAG
AACGGATACCAGCCCCAGAGTGACCTGCTGCCCACTCCTCCTCCGATCCC
AGCTGCCATCCTGAAGGCTATCGCCTACATCGAGGCTAACCCCAGCAAGA
ACGCAAGCTTTCTAGACC

BO11588.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG2043-PA 339 Lcp3-RA 1..336 17..352 1680 100 Plus
CG2044-PA 339 Lcp4-RA 214..315 230..331 335 93.1 Plus
CG2044-PA 339 Lcp4-RA 61..119 77..135 195 93.2 Plus
CG2044-PA 339 Lcp4-RA 155..200 171..216 155 93.4 Plus
CG7941-PA 405 CG7941-RA 286..320 278..312 150 97.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp3-RB 730 CG2043-RB 180..515 17..352 1680 100 Plus
Lcp3-RA 513 CG2043-RA 47..382 17..352 1680 100 Plus
Lcp4-RB 527 CG2044-RB 43..382 10..349 995 86.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8435557..8435880 29..352 1620 100 Plus
2R 25286936 2R 8437765..8438085 29..349 930 86 Plus
3L 28110227 3L 10890454..10890525 241..312 240 88.9 Plus
3L 28110227 3L 10892254..10892325 241..312 210 86.1 Plus
Blast to na_te.dros performed on 2015-02-11 10:48:41 has no hits.

BO11588.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:48 Download gff for BO11588.5prime
Subject Subject Range Query Range Percent Splice Strand
Lcp3-PA 1..339 17..356 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:36:06 Download gff for BO11588.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2043-PA 1..339 17..356 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 16:38:13 Download gff for BO11588.5prime
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 42..386 12..357 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:25:32 Download gff for BO11588.5prime
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 42..386 12..357 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:25:32 Download gff for BO11588.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 8435557..8435884 29..357 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 16:38:13 Download gff for BO11588.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4323062..4323389 29..357 99   Plus

BO11588.3prime Sequence

368 bp (367 high quality bases) assembled on 2006-04-19

> BO11588.3prime
ATGGTCTAGAAAGCTTGCGTTCTTGCTGGGGTTAGCCTCGATGTAGGCGA
TAGCCTTCAGGATGGCAGCTGGGATCGGAGGAGGAGTGGGCAGCAGGTCA
CTCTGGGGCTGGTATCCGTTCTCGTCAGCCTTGTAGCTCACTCGCACATG
GACACCCTCGGGGGAGATCCACTCGAAGACTCCGTCGATGTTGCCGTGGA
TGTCTCCGGTGGCGGAGGAGGCAGATCCGTCGTCGAGGACCAACTTGCTG
ACAAAGCCATCGGGCTGGACATCGTTGACCAGCTCCTTGACCTCCACATT
AGCGTTGGCGGCCACCAGGGCGGCGAGAGAACAGACAAGCAGGATCTTGA
ACATGTCGACTGATAACT

BO11588.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG2043-PA 339 Lcp3-RA 1..336 354..19 1680 100 Minus
CG2044-PA 339 Lcp4-RA 214..315 141..40 335 93.1 Minus
CG2044-PA 339 Lcp4-RA 61..119 294..236 195 93.2 Minus
CG2044-PA 339 Lcp4-RA 155..200 200..155 155 93.4 Minus
CG7941-PA 405 CG7941-RA 286..320 93..59 150 97.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp3-RB 730 CG2043-RB 180..515 354..19 1680 100 Minus
Lcp3-RA 513 CG2043-RA 47..382 354..19 1680 100 Minus
Lcp4-RB 527 CG2044-RB 43..382 361..22 995 86.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 12:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8435557..8435880 342..19 1620 100 Minus
2R 25286936 2R 8437765..8438085 342..22 930 86 Minus
3L 28110227 3L 10890454..10890525 130..59 240 88.9 Minus
3L 28110227 3L 10892254..10892325 130..59 210 86.1 Minus
Blast to na_te.dros performed on 2015-02-11 12:13:50 has no hits.

BO11588.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:10:47 Download gff for BO11588.3prime
Subject Subject Range Query Range Percent Splice Strand
Lcp3-PA 1..339 15..354 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:36:04 Download gff for BO11588.3prime
Subject Subject Range Query Range Percent Splice Strand
CG2043-PA 1..339 15..354 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 23:24:18 Download gff for BO11588.3prime
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 42..386 14..359 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 13:32:10 Download gff for BO11588.3prime
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 42..386 14..359 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 13:32:10 Download gff for BO11588.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 8435557..8435884 14..342 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 23:24:18 Download gff for BO11588.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4323062..4323389 14..342 99   Minus

BO11588.complete Sequence

370 bp assembled on 2006-10-11

GenBank Submission: FJ632116

> BO11588.complete
GAAGTTATCAGTCGACATGTTCAAGATCCTGCTTGTCTGTTCTCTCGCCG
CCCTGGTGGCCGCCAACGCTAATGTGGAGGTCAAGGAGCTGGTCAACGAT
GTCCAGCCCGATGGCTTTGTCAGCAAGTTGGTCCTCGACGACGGATCTGC
CTCCTCCGCCACCGGAGACATCCACGGCAACATCGACGGAGTCTTCGAGT
GGATCTCCCCCGAGGGTGTCCATGTGCGAGTGAGCTACAAGGCTGACGAG
AACGGATACCAGCCCCAGAGTGACCTGCTGCCCACTCCTCCTCCGATCCC
AGCTGCCATCCTGAAGGCTATCGCCTACATCGAGGCTAACCCCAGCAAGA
ACGCAAGCTTTCTAGACCAT

BO11588.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp3-RB 339 CG2043-PB 1..336 17..352 1680 100 Plus
Lcp3-RA 339 CG2043-PA 1..336 17..352 1680 100 Plus
Lcp4-RB 339 CG2044-PB 1..333 17..349 990 86.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp3-RB 730 CG2043-RB 180..515 17..352 1680 100 Plus
Lcp3-RA 513 CG2043-RA 47..382 17..352 1680 100 Plus
Lcp4-RB 527 CG2044-RB 43..382 10..349 995 86.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8435557..8435880 29..352 1620 100 Plus
2R 25286936 2R 8437765..8438085 29..349 930 86 Plus
3L 28110227 3L 10890454..10890525 241..312 240 88.9 Plus
3L 28110227 3L 10892254..10892325 241..312 210 86.1 Plus
Blast to na_te.dros performed on 2014-11-27 16:40:17 has no hits.

BO11588.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:50:19 Download gff for BO11588.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 1..339 17..356 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:05:31 Download gff for BO11588.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 41..385 12..357 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:57:50 Download gff for BO11588.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 52..382 22..354 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:50:20 Download gff for BO11588.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 41..385 12..357 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:23:55 Download gff for BO11588.complete
Subject Subject Range Query Range Percent Splice Strand
Lcp3-RA 52..382 22..354 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:23:55 Download gff for BO11588.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8435553..8435880 22..354 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:57:50 Download gff for BO11588.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4323058..4323385 22..354 98   Plus

BO11588.pep Sequence

Translation from 16 to 370

> BO11588.pep
MFKILLVCSLAALVAANANVEVKELVNDVQPDGFVSKLVLDDGSASSATG
DIHGNIDGVFEWISPEGVHVRVSYKADENGYQPQSDLLPTPPPIPAAILK
AIAYIEANPSKNASFLDH

BO11588.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
Lcp3-PB 112 CG2043-PB 1..112 1..112 573 100 Plus
Lcp3-PA 112 CG2043-PA 1..112 1..112 573 100 Plus
Lcp4-PB 112 CG2044-PB 1..111 1..111 512 88.3 Plus
Lcp4-PA 112 CG2044-PA 1..111 1..111 512 88.3 Plus
Lcp1-PB 130 CG11650-PB 1..121 1..109 281 46.3 Plus