Clone Sequence Records
BO11766.3prime Sequence
335 bp (334 high quality bases) assembled on 2006-04-19
> BO11766.3prime
ATGGTCTAGAAAGCTTGCACACCGAAGCCTTTCAATACTTACCAGATTGG
TAAAATGGAAGCCACCTTTCCAAATGTTGGTCTTGGCGTTACCTGGCGTC
GTCGATTGGGTGATGGATGGCGTTGGCTTGGCCAGTACAGCGGGCGTGGA
AGCCACCGTGGGCTTAATCAGCTTACTCAACTTCGAGGGTGGTCCAATGG
GCACCCGGACGGTGACCTTCTTCTTCGGATTCAGCTGCAATTGGGTCTGG
TGGTAGGTATATTCGATGTCCTTCGCCGGGGACAAGGATTGCAGCCGAGG
CAGATCCTCTAAGTCGATCATGTCGACTGATAACT
BO11766.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:30:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13826-PA | 306 | CG13826-RA | 1..303 | 321..19 | 1515 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:20:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 4746 | CG43286-RN | 313..592 | 321..42 | 1400 | 100 | Minus |
cnc-RM | 4737 | CG43286-RM | 304..583 | 321..42 | 1400 | 100 | Minus |
cnc-RI | 4750 | CG43286-RI | 317..596 | 321..42 | 1400 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:20:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23222773..23223075 | 19..321 | 1515 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-10 20:20:52 has no hits.
BO11766.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:16:09 Download gff for
BO11766.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 15..321 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:43:36 Download gff for
BO11766.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 15..321 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 20:37:45 Download gff for
BO11766.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 32..329 | 97 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:13:17 Download gff for
BO11766.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 32..329 | 97 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 22:13:17 Download gff for
BO11766.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23222768..23223080 | 11..329 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:45 Download gff for
BO11766.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19048490..19048802 | 11..329 | 97 | | Plus |
BO11766.5prime Sequence
335 bp (334 high quality bases) assembled on 2006-04-19
> BO11766.5prime
GAAGTTATCAGTCGACATGATCGACTTAGAGGATCTGCCTCGGCTGCAAT
CCTTGTCCCCGGCGAAGGACATCGAATATACCTACCACCAGACCCAATTG
CAGCTGAATCCGAAGAAGAAGGTCACCGTCCGGGTGCCCATTGGACCACC
CTCGAAGTTGAGTAAGCTGATTAAGCCCACGGTGGCTTCCACGCCCGCTG
TACTGGCCAAGCCAACGCCATCCATCACCCAATCGACGACGCCAGGTAAC
GCCAAGACCAACATTTGGAAAGGTGGCTTCCATTTTACCAATCTGGTAAG
TATTGAAAGGCTTCGGTGTGCAAGCTTTCTAGACC
BO11766.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:30:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13826-PA | 306 | CG13826-RA | 1..303 | 17..319 | 1515 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:53:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 4746 | CG43286-RN | 313..592 | 17..296 | 1400 | 100 | Plus |
cnc-RM | 4737 | CG43286-RM | 304..583 | 17..296 | 1400 | 100 | Plus |
cnc-RI | 4750 | CG43286-RI | 317..596 | 17..296 | 1400 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:53:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23222773..23223075 | 319..17 | 1515 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-13 09:53:18 has no hits.
BO11766.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:16:10 Download gff for
BO11766.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 17..323 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:43:38 Download gff for
BO11766.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-PA | 1..306 | 17..323 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 11:47:28 Download gff for
BO11766.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 9..306 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:26:50 Download gff for
BO11766.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 312..603 | 9..306 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:26:50 Download gff for
BO11766.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23222768..23223080 | 9..327 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 11:47:28 Download gff for
BO11766.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19048490..19048802 | 9..327 | 97 | | Minus |
BO11766.complete Sequence
337 bp assembled on 2006-10-11
GenBank Submission: FJ632187
> BO11766.complete
GAAGTTATCAGTCGACATGATCGACTTAGAGGATCTGCCTCGGCTGCAAT
CCTTGTCCCCGGCGAAGGACATCGAATATACCTACCACCAGACCCAATTG
CAGCTGAATCCGAAGAAGAAGGTCACCGTCCGGGTGCCCATTGGACCACC
CTCGAAGTTGAGTAAGCTGATTAAGCCCACGGTGGCTTCCACGCCCGCTG
TACTGGCCAAGCCAACGCCATCCATCACCCAATCGACGACGCCAGGTAAC
GCCAAGACCAACATTTGGAAAGGTGGCTTCCATTTTACCAATCTGGTAAG
TATTGAAAGGCTTCGGTGTGCAAGCTTTCTAGACCAT
BO11766.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:58:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 3402 | CG43286-PN | 1..280 | 17..296 | 1400 | 100 | Plus |
cnc-RM | 3402 | CG43286-PM | 1..280 | 17..296 | 1400 | 100 | Plus |
cnc-RI | 3402 | CG43286-PI | 1..280 | 17..296 | 1400 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-RN | 4746 | CG43286-RN | 313..592 | 17..296 | 1400 | 100 | Plus |
cnc-RM | 4737 | CG43286-RM | 304..583 | 17..296 | 1400 | 100 | Plus |
cnc-RI | 4750 | CG43286-RI | 317..596 | 17..296 | 1400 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:58:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23222773..23223075 | 319..17 | 1515 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:58:33 has no hits.
BO11766.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:49:44 Download gff for
BO11766.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-RA | 1..306 | 17..323 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:03:25 Download gff for
BO11766.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-RA | 309..621 | 9..327 | 97 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:46:53 Download gff for
BO11766.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 317..603 | 17..306 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:49:44 Download gff for
BO11766.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13826-RA | 309..621 | 9..327 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:07:16 Download gff for
BO11766.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cnc-RI | 317..603 | 17..306 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:07:16 Download gff for
BO11766.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23222771..23223075 | 17..321 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:53 Download gff for
BO11766.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19048493..19048797 | 17..321 | 99 | | Minus |
BO11766.pep Sequence
Translation from 16 to 337
> BO11766.pep
MIDLEDLPRLQSLSPAKDIEYTYHQTQLQLNPKKKVTVRVPIGPPSKLSK
LIKPTVASTPAVLAKPTPSITQSTTPGNAKTNIWKGGFHFTNLVSIERLR
CASFLDH
BO11766.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:30:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cnc-PN | 1133 | CG43286-PN | 1..95 | 1..95 | 485 | 98.9 | Plus |
cnc-PM | 1133 | CG43286-PM | 1..95 | 1..95 | 485 | 98.9 | Plus |
cnc-PI | 1133 | CG43286-PI | 1..95 | 1..95 | 485 | 98.9 | Plus |