Clone BO11766 Report

Search the DGRC for BO11766

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:117
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG13826-RA
Protein status:BO11766.pep: validated full length
Sequenced Size:337

Clone Sequence Records

BO11766.3prime Sequence

335 bp (334 high quality bases) assembled on 2006-04-19

> BO11766.3prime
ATGGTCTAGAAAGCTTGCACACCGAAGCCTTTCAATACTTACCAGATTGG
TAAAATGGAAGCCACCTTTCCAAATGTTGGTCTTGGCGTTACCTGGCGTC
GTCGATTGGGTGATGGATGGCGTTGGCTTGGCCAGTACAGCGGGCGTGGA
AGCCACCGTGGGCTTAATCAGCTTACTCAACTTCGAGGGTGGTCCAATGG
GCACCCGGACGGTGACCTTCTTCTTCGGATTCAGCTGCAATTGGGTCTGG
TGGTAGGTATATTCGATGTCCTTCGCCGGGGACAAGGATTGCAGCCGAGG
CAGATCCTCTAAGTCGATCATGTCGACTGATAACT

BO11766.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13826-PA 306 CG13826-RA 1..303 321..19 1515 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RN 4746 CG43286-RN 313..592 321..42 1400 100 Minus
cnc-RM 4737 CG43286-RM 304..583 321..42 1400 100 Minus
cnc-RI 4750 CG43286-RI 317..596 321..42 1400 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23222773..23223075 19..321 1515 100 Plus
Blast to na_te.dros performed on 2015-02-10 20:20:52 has no hits.

BO11766.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:16:09 Download gff for BO11766.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13826-PA 1..306 15..321 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:43:36 Download gff for BO11766.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13826-PA 1..306 15..321 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 20:37:45 Download gff for BO11766.3prime
Subject Subject Range Query Range Percent Splice Strand
cnc-RI 312..603 32..329 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:13:17 Download gff for BO11766.3prime
Subject Subject Range Query Range Percent Splice Strand
cnc-RI 312..603 32..329 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 22:13:17 Download gff for BO11766.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 23222768..23223080 11..329 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 20:37:45 Download gff for BO11766.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19048490..19048802 11..329 97   Plus

BO11766.5prime Sequence

335 bp (334 high quality bases) assembled on 2006-04-19

> BO11766.5prime
GAAGTTATCAGTCGACATGATCGACTTAGAGGATCTGCCTCGGCTGCAAT
CCTTGTCCCCGGCGAAGGACATCGAATATACCTACCACCAGACCCAATTG
CAGCTGAATCCGAAGAAGAAGGTCACCGTCCGGGTGCCCATTGGACCACC
CTCGAAGTTGAGTAAGCTGATTAAGCCCACGGTGGCTTCCACGCCCGCTG
TACTGGCCAAGCCAACGCCATCCATCACCCAATCGACGACGCCAGGTAAC
GCCAAGACCAACATTTGGAAAGGTGGCTTCCATTTTACCAATCTGGTAAG
TATTGAAAGGCTTCGGTGTGCAAGCTTTCTAGACC

BO11766.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13826-PA 306 CG13826-RA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RN 4746 CG43286-RN 313..592 17..296 1400 100 Plus
cnc-RM 4737 CG43286-RM 304..583 17..296 1400 100 Plus
cnc-RI 4750 CG43286-RI 317..596 17..296 1400 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23222773..23223075 319..17 1515 100 Minus
Blast to na_te.dros performed on 2015-02-13 09:53:18 has no hits.

BO11766.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:16:10 Download gff for BO11766.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13826-PA 1..306 17..323 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:43:38 Download gff for BO11766.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13826-PA 1..306 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 11:47:28 Download gff for BO11766.5prime
Subject Subject Range Query Range Percent Splice Strand
cnc-RI 312..603 9..306 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:26:50 Download gff for BO11766.5prime
Subject Subject Range Query Range Percent Splice Strand
cnc-RI 312..603 9..306 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:26:50 Download gff for BO11766.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 23222768..23223080 9..327 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 11:47:28 Download gff for BO11766.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19048490..19048802 9..327 97   Minus

BO11766.complete Sequence

337 bp assembled on 2006-10-11

GenBank Submission: FJ632187

> BO11766.complete
GAAGTTATCAGTCGACATGATCGACTTAGAGGATCTGCCTCGGCTGCAAT
CCTTGTCCCCGGCGAAGGACATCGAATATACCTACCACCAGACCCAATTG
CAGCTGAATCCGAAGAAGAAGGTCACCGTCCGGGTGCCCATTGGACCACC
CTCGAAGTTGAGTAAGCTGATTAAGCCCACGGTGGCTTCCACGCCCGCTG
TACTGGCCAAGCCAACGCCATCCATCACCCAATCGACGACGCCAGGTAAC
GCCAAGACCAACATTTGGAAAGGTGGCTTCCATTTTACCAATCTGGTAAG
TATTGAAAGGCTTCGGTGTGCAAGCTTTCTAGACCAT

BO11766.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RN 3402 CG43286-PN 1..280 17..296 1400 100 Plus
cnc-RM 3402 CG43286-PM 1..280 17..296 1400 100 Plus
cnc-RI 3402 CG43286-PI 1..280 17..296 1400 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-RN 4746 CG43286-RN 313..592 17..296 1400 100 Plus
cnc-RM 4737 CG43286-RM 304..583 17..296 1400 100 Plus
cnc-RI 4750 CG43286-RI 317..596 17..296 1400 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23222773..23223075 319..17 1515 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:58:33 has no hits.

BO11766.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:49:44 Download gff for BO11766.complete
Subject Subject Range Query Range Percent Splice Strand
CG13826-RA 1..306 17..323 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:03:25 Download gff for BO11766.complete
Subject Subject Range Query Range Percent Splice Strand
CG13826-RA 309..621 9..327 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:46:53 Download gff for BO11766.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RI 317..603 17..306 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:49:44 Download gff for BO11766.complete
Subject Subject Range Query Range Percent Splice Strand
CG13826-RA 309..621 9..327 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:07:16 Download gff for BO11766.complete
Subject Subject Range Query Range Percent Splice Strand
cnc-RI 317..603 17..306 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:07:16 Download gff for BO11766.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23222771..23223075 17..321 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:46:53 Download gff for BO11766.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19048493..19048797 17..321 99   Minus

BO11766.pep Sequence

Translation from 16 to 337

> BO11766.pep
MIDLEDLPRLQSLSPAKDIEYTYHQTQLQLNPKKKVTVRVPIGPPSKLSK
LIKPTVASTPAVLAKPTPSITQSTTPGNAKTNIWKGGFHFTNLVSIERLR
CASFLDH

BO11766.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
cnc-PN 1133 CG43286-PN 1..95 1..95 485 98.9 Plus
cnc-PM 1133 CG43286-PM 1..95 1..95 485 98.9 Plus
cnc-PI 1133 CG43286-PI 1..95 1..95 485 98.9 Plus