Clone BO12024 Report

Search the DGRC for BO12024

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:120
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG17290-RA
Protein status:BO12024.pep:
Sequenced Size:331

Clone Sequence Records

BO12024.5prime Sequence

329 bp (328 high quality bases) assembled on 2006-04-18

> BO12024.5prime
GAAGTTATCAGTCGACATGAAATTCCTGATCATTGCCATCGCCTTCTTGG
CCTGCGCATTCGCCGATGTCTCGGAGCTTTCTGGCTACGACTACCAGCAG
CCAGCTCCTGCTCCCGTGGAAACCTACATCCCACCTGCACCGCCAGCACC
TGCTCCCGTCGAGACCTACATCCCACCTGCACCACCAGCACCCGAGTACA
TCCCACCTGCTCCTGTCCAGGCCGAGGAACCCATCATCGAGGAGATCGAG
CAGCCCGCCCAGGACGGCTACCGCTACAAGACCGTCCGCCGCCACGTCTT
CCGTCACCGCAACGCAAGCTTTCTAGACC

BO12024.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-PA 300 CG17290-RA 1..297 17..313 1485 100 Plus
CG30458-PA 438 CG30458-RA 319..435 197..313 460 95.7 Plus
CG30458-PA 438 CG30458-RA 1..41 17..57 155 95.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-RC 2443 CG17290-RC 153..450 16..313 1490 100 Plus
CG17290-RA 440 CG17290-RA 45..342 16..313 1490 100 Plus
CG30458-RA 614 CG30458-RA 300..491 122..313 660 89.6 Plus
CG17290-RC 2443 CG17290-RC 237..287 142..192 195 92.2 Plus
CG17290-RC 2443 CG17290-RC 279..329 100..150 195 92.2 Plus
CG17290-RA 440 CG17290-RA 129..179 142..192 195 92.2 Plus
CG17290-RA 440 CG17290-RA 171..221 100..150 195 92.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:57:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17154838..17155132 19..313 1475 100 Plus
2R 25286936 2R 17158448..17158639 313..122 660 89.6 Minus
2R 25286936 2R 17154919..17154969 142..192 195 92.2 Plus
2R 25286936 2R 17154961..17155011 100..150 195 92.2 Plus
2R 25286936 2R 17158822..17158880 77..19 190 88.1 Minus
Blast to na_te.dros performed on 2015-02-13 09:57:25 has no hits.

BO12024.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:23:43 Download gff for BO12024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17290-PA 1..300 17..317 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:54:20 Download gff for BO12024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17290-PA 1..300 17..317 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 11:49:09 Download gff for BO12024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 45..346 16..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:11:33 Download gff for BO12024.5prime
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 45..346 16..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:11:33 Download gff for BO12024.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 17154836..17155136 16..318 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 11:49:09 Download gff for BO12024.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13042341..13042641 16..318 99   Plus

BO12024.complete Sequence

331 bp assembled on 2007-10-29

GenBank Submission: FJ632283

> BO12024.complete
GAAGTTATCAGTCGACATGAAATTCCTGATCATTGCCATCGCCTTCTTGG
CCTGCGCATTCGCCGATGTCTCGGAGCTTTCTGGCTACGACTACCAGCAG
CCAGCTCCTGCTCCCGTGGAAACCTACATCCCACCTGCACCGCCAGCACC
TGCTCCCGTCGAGACCTACATCCCACCTGCACCACCAGCACCCGAGTACA
TCCCACCTGCTCCTGTCCAGGCCGAGGAACCCATCATCGAGGAGATCGAG
CAGCCCGCCCAGGACGGCTACCGCTACAAGACCGTCCGCCGCCACGTCTT
CCGTCACCGCAACGCAAGCTTTCTAGACCAT

BO12024.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-RC 300 CG17290-PC 1..297 17..313 1485 100 Plus
CG17290-RA 300 CG17290-PA 1..297 17..313 1485 100 Plus
CG30458-RA 438 CG30458-PA 244..435 122..313 660 89.6 Plus
CG17290-RC 300 CG17290-PC 84..134 142..192 195 92.2 Plus
CG17290-RC 300 CG17290-PC 126..176 100..150 195 92.2 Plus
CG17290-RA 300 CG17290-PA 84..134 142..192 195 92.2 Plus
CG17290-RA 300 CG17290-PA 126..176 100..150 195 92.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-RC 2443 CG17290-RC 153..450 16..313 1490 100 Plus
CG17290-RA 440 CG17290-RA 45..342 16..313 1490 100 Plus
CG30458-RA 614 CG30458-RA 300..491 122..313 660 89.6 Plus
CG17290-RC 2443 CG17290-RC 237..287 142..192 195 92.2 Plus
CG17290-RC 2443 CG17290-RC 279..329 100..150 195 92.2 Plus
CG17290-RA 440 CG17290-RA 129..179 142..192 195 92.2 Plus
CG17290-RA 440 CG17290-RA 171..221 100..150 195 92.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17154838..17155132 19..313 1475 100 Plus
2R 25286936 2R 17158448..17158639 313..122 660 89.6 Minus
2R 25286936 2R 17154919..17154969 142..192 195 92.2 Plus
2R 25286936 2R 17154961..17155011 100..150 195 92.2 Plus
2R 25286936 2R 17158822..17158880 77..19 190 88.1 Minus
Blast to na_te.dros performed on 2014-11-27 10:20:11 has no hits.

BO12024.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:59:40 Download gff for BO12024.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 1..300 17..317 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:01:05 Download gff for BO12024.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 43..344 16..318 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:07:23 Download gff for BO12024.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 46..342 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:39:54 Download gff for BO12024.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 44..340 17..315 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:06 Download gff for BO12024.complete
Subject Subject Range Query Range Percent Splice Strand
CG17290-RA 46..342 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:19:06 Download gff for BO12024.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17154837..17155132 17..315 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:07:23 Download gff for BO12024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13042342..13042637 17..315 98   Plus

BO12024.pep Sequence

Translation from 16 to 331

> BO12024.pep
MKFLIIAIAFLACAFADVSELSGYDYQQPAPAPVETYIPPAPPAPAPVET
YIPPAPPAPEYIPPAPVQAEEPIIEEIEQPAQDGYRYKTVRRHVFRHRNA
SFLDH

BO12024.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG17290-PC 99 CG17290-PC 1..99 1..99 532 100 Plus
CG17290-PA 99 CG17290-PA 1..99 1..99 532 100 Plus
CG30458-PA 145 CG30458-PA 1..145 1..99 380 59.3 Plus
CG30457-PA 189 CG30457-PA 1..187 1..96 228 38 Plus
CG10953-PB 278 CG10953-PB 200..277 29..98 200 55.1 Plus