Clone Sequence Records
BO12024.5prime Sequence
329 bp (328 high quality bases) assembled on 2006-04-18
> BO12024.5prime
GAAGTTATCAGTCGACATGAAATTCCTGATCATTGCCATCGCCTTCTTGG
CCTGCGCATTCGCCGATGTCTCGGAGCTTTCTGGCTACGACTACCAGCAG
CCAGCTCCTGCTCCCGTGGAAACCTACATCCCACCTGCACCGCCAGCACC
TGCTCCCGTCGAGACCTACATCCCACCTGCACCACCAGCACCCGAGTACA
TCCCACCTGCTCCTGTCCAGGCCGAGGAACCCATCATCGAGGAGATCGAG
CAGCCCGCCCAGGACGGCTACCGCTACAAGACCGTCCGCCGCCACGTCTT
CCGTCACCGCAACGCAAGCTTTCTAGACC
BO12024.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:35:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17290-PA | 300 | CG17290-RA | 1..297 | 17..313 | 1485 | 100 | Plus |
CG30458-PA | 438 | CG30458-RA | 319..435 | 197..313 | 460 | 95.7 | Plus |
CG30458-PA | 438 | CG30458-RA | 1..41 | 17..57 | 155 | 95.1 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:57:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17290-RC | 2443 | CG17290-RC | 153..450 | 16..313 | 1490 | 100 | Plus |
CG17290-RA | 440 | CG17290-RA | 45..342 | 16..313 | 1490 | 100 | Plus |
CG30458-RA | 614 | CG30458-RA | 300..491 | 122..313 | 660 | 89.6 | Plus |
CG17290-RC | 2443 | CG17290-RC | 237..287 | 142..192 | 195 | 92.2 | Plus |
CG17290-RC | 2443 | CG17290-RC | 279..329 | 100..150 | 195 | 92.2 | Plus |
CG17290-RA | 440 | CG17290-RA | 129..179 | 142..192 | 195 | 92.2 | Plus |
CG17290-RA | 440 | CG17290-RA | 171..221 | 100..150 | 195 | 92.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:57:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17154838..17155132 | 19..313 | 1475 | 100 | Plus |
2R | 25286936 | 2R | 17158448..17158639 | 313..122 | 660 | 89.6 | Minus |
2R | 25286936 | 2R | 17154919..17154969 | 142..192 | 195 | 92.2 | Plus |
2R | 25286936 | 2R | 17154961..17155011 | 100..150 | 195 | 92.2 | Plus |
2R | 25286936 | 2R | 17158822..17158880 | 77..19 | 190 | 88.1 | Minus |
Blast to na_te.dros performed on 2015-02-13 09:57:25 has no hits.
BO12024.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:23:43 Download gff for
BO12024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-PA | 1..300 | 17..317 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:54:20 Download gff for
BO12024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-PA | 1..300 | 17..317 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 11:49:09 Download gff for
BO12024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-RA | 45..346 | 16..318 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:11:33 Download gff for
BO12024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-RA | 45..346 | 16..318 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 14:11:33 Download gff for
BO12024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17154836..17155136 | 16..318 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 11:49:09 Download gff for
BO12024.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13042341..13042641 | 16..318 | 99 | | Plus |
BO12024.complete Sequence
331 bp assembled on 2007-10-29
GenBank Submission: FJ632283
> BO12024.complete
GAAGTTATCAGTCGACATGAAATTCCTGATCATTGCCATCGCCTTCTTGG
CCTGCGCATTCGCCGATGTCTCGGAGCTTTCTGGCTACGACTACCAGCAG
CCAGCTCCTGCTCCCGTGGAAACCTACATCCCACCTGCACCGCCAGCACC
TGCTCCCGTCGAGACCTACATCCCACCTGCACCACCAGCACCCGAGTACA
TCCCACCTGCTCCTGTCCAGGCCGAGGAACCCATCATCGAGGAGATCGAG
CAGCCCGCCCAGGACGGCTACCGCTACAAGACCGTCCGCCGCCACGTCTT
CCGTCACCGCAACGCAAGCTTTCTAGACCAT
BO12024.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17290-RC | 300 | CG17290-PC | 1..297 | 17..313 | 1485 | 100 | Plus |
CG17290-RA | 300 | CG17290-PA | 1..297 | 17..313 | 1485 | 100 | Plus |
CG30458-RA | 438 | CG30458-PA | 244..435 | 122..313 | 660 | 89.6 | Plus |
CG17290-RC | 300 | CG17290-PC | 84..134 | 142..192 | 195 | 92.2 | Plus |
CG17290-RC | 300 | CG17290-PC | 126..176 | 100..150 | 195 | 92.2 | Plus |
CG17290-RA | 300 | CG17290-PA | 84..134 | 142..192 | 195 | 92.2 | Plus |
CG17290-RA | 300 | CG17290-PA | 126..176 | 100..150 | 195 | 92.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17290-RC | 2443 | CG17290-RC | 153..450 | 16..313 | 1490 | 100 | Plus |
CG17290-RA | 440 | CG17290-RA | 45..342 | 16..313 | 1490 | 100 | Plus |
CG30458-RA | 614 | CG30458-RA | 300..491 | 122..313 | 660 | 89.6 | Plus |
CG17290-RC | 2443 | CG17290-RC | 237..287 | 142..192 | 195 | 92.2 | Plus |
CG17290-RC | 2443 | CG17290-RC | 279..329 | 100..150 | 195 | 92.2 | Plus |
CG17290-RA | 440 | CG17290-RA | 129..179 | 142..192 | 195 | 92.2 | Plus |
CG17290-RA | 440 | CG17290-RA | 171..221 | 100..150 | 195 | 92.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:20:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 17154838..17155132 | 19..313 | 1475 | 100 | Plus |
2R | 25286936 | 2R | 17158448..17158639 | 313..122 | 660 | 89.6 | Minus |
2R | 25286936 | 2R | 17154919..17154969 | 142..192 | 195 | 92.2 | Plus |
2R | 25286936 | 2R | 17154961..17155011 | 100..150 | 195 | 92.2 | Plus |
2R | 25286936 | 2R | 17158822..17158880 | 77..19 | 190 | 88.1 | Minus |
Blast to na_te.dros performed on 2014-11-27 10:20:11 has no hits.
BO12024.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:59:40 Download gff for
BO12024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-RA | 1..300 | 17..317 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:01:05 Download gff for
BO12024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-RA | 43..344 | 16..318 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:07:23 Download gff for
BO12024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-RA | 46..342 | 17..315 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:39:54 Download gff for
BO12024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-RA | 44..340 | 17..315 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:19:06 Download gff for
BO12024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17290-RA | 46..342 | 17..315 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:19:06 Download gff for
BO12024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 17154837..17155132 | 17..315 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:07:23 Download gff for
BO12024.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 13042342..13042637 | 17..315 | 98 | | Plus |
BO12024.pep Sequence
Translation from 16 to 331
> BO12024.pep
MKFLIIAIAFLACAFADVSELSGYDYQQPAPAPVETYIPPAPPAPAPVET
YIPPAPPAPEYIPPAPVQAEEPIIEEIEQPAQDGYRYKTVRRHVFRHRNA
SFLDH
BO12024.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:27:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17290-PC | 99 | CG17290-PC | 1..99 | 1..99 | 532 | 100 | Plus |
CG17290-PA | 99 | CG17290-PA | 1..99 | 1..99 | 532 | 100 | Plus |
CG30458-PA | 145 | CG30458-PA | 1..145 | 1..99 | 380 | 59.3 | Plus |
CG30457-PA | 189 | CG30457-PA | 1..187 | 1..96 | 228 | 38 | Plus |
CG10953-PB | 278 | CG10953-PB | 200..277 | 29..98 | 200 | 55.1 | Plus |