Clone BO12031 Report

Search the DGRC for BO12031

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:120
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG9921-RA
Protein status:BO12031.pep: validated full length
Sequenced Size:340

Clone Sequence Records

BO12031.3prime Sequence

338 bp (337 high quality bases) assembled on 2006-04-18

> BO12031.3prime
ATGGTCTAGAAAGCTTGCTTTTTTATCAGTGTAGGTCATGACGACGCCGA
CAACTAGGGCCATAACGGTAAATCCCTGAGCCGCGATACGACTTCGCATC
ATCAGCTGCGACATCTTGCGATTGCCAGTGCGAAAGTTGTATAAGCCAGC
TGTGAGCGCCGCTGTAGTGGCCAAACATCCCAACGGAACCAGCGGATTCT
CCTTGATCTTGCGCTGCAACTTCTCCTTGGTCGTTTCCACCTCGGCAACG
GGTCCCAGGTCCTGGCGCAATTGTATCCAATCCAGTTCCTCCTCCGGAAG
CGAGACTTCAATTTTGTTCGACATGTCGACTGATAACT

BO12031.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:35:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PA 309 CG9921-RA 1..306 324..19 1530 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-07 02:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 985 CG9921-RC 392..701 328..19 1535 99.7 Minus
CG9921-RB 685 CG9921-RB 92..401 328..19 1535 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-07 02:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16331565..16331726 19..180 810 100 Plus
X 23542271 X 16331808..16331957 179..328 735 99.3 Plus
Blast to na_te.dros performed on 2015-02-07 02:52:57 has no hits.

BO12031.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:23:56 Download gff for BO12031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-PA 1..309 15..324 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:54:42 Download gff for BO12031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-PA 1..309 15..324 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 11:29:08 Download gff for BO12031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 12..335 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-07 06:07:56 Download gff for BO12031.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 12..335 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-07 06:07:56 Download gff for BO12031.3prime
Subject Subject Range Query Range Percent Splice Strand
X 16331560..16331725 12..179 98 <- Plus
X 16331809..16331963 180..335 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 11:29:08 Download gff for BO12031.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16225593..16225758 12..179 98 <- Plus
arm_X 16225842..16225996 180..335 97   Plus

BO12031.5prime Sequence

338 bp (337 high quality bases) assembled on 2006-04-18

> BO12031.5prime
GAAGTTATCAGTCGACATGTCGAACAAAATTGAAGTCTCGCTTCCGGAGG
AGGAACTGGATTGGATACAATTGCGCCAGGACCTGGGACCCGTTGCCGAG
GTGGAAACGACCAAGGAGAAGTTGCAGCGCAAGATCAAGGAGAATCCGCT
GGTTCCGTTGGGATGTTTGGCCACTACAGCGGCGCTCACAGCTGGCTTAT
ACAACTTTCGCACTGGCAATCGCAAGATGTCGCAGCTGATGATGCGAAGT
CGTATCGCGGCTCAGGGATTTACCGTTATGGCCCTAGTTGTCGGCGTCGT
CATGACCTACACTGATAAAAAAGCAAGCTTTCTAGACC

BO12031.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:35:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PA 309 CG9921-RA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 05:35:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 985 CG9921-RC 392..701 13..322 1535 99.7 Plus
CG9921-RB 685 CG9921-RB 92..401 13..322 1535 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 05:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16331565..16331726 322..161 810 100 Minus
X 23542271 X 16331808..16331957 162..13 735 99.3 Minus
Blast to na_te.dros performed on 2015-02-04 05:35:05 has no hits.

BO12031.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:23:57 Download gff for BO12031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-PA 1..309 17..326 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 04:54:43 Download gff for BO12031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-PA 1..309 17..326 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 07:15:26 Download gff for BO12031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 6..329 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 06:47:09 Download gff for BO12031.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 86..406 6..329 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 06:47:09 Download gff for BO12031.5prime
Subject Subject Range Query Range Percent Splice Strand
X 16331560..16331725 162..329 98 <- Minus
X 16331809..16331963 6..161 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 07:15:26 Download gff for BO12031.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16225593..16225758 162..329 98 <- Minus
arm_X 16225842..16225996 6..161 97   Minus

BO12031.complete Sequence

340 bp assembled on 2006-10-11

GenBank Submission: FJ632288

> BO12031.complete
GAAGTTATCAGTCGACATGTCGAACAAAATTGAAGTCTCGCTTCCGGAGG
AGGAACTGGATTGGATACAATTGCGCCAGGACCTGGGACCCGTTGCCGAG
GTGGAAACGACCAAGGAGAAGTTGCAGCGCAAGATCAAGGAGAATCCGCT
GGTTCCGTTGGGATGTTTGGCCACTACAGCGGCGCTCACAGCTGGCTTAT
ACAACTTTCGCACTGGCAATCGCAAGATGTCGCAGCTGATGATGCGAAGT
CGTATCGCGGCTCAGGGATTTACCGTTATGGCCCTAGTTGTCGGCGTCGT
CATGACCTACACTGATAAAAAAGCAAGCTTTCTAGACCAT

BO12031.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 309 CG9921-PC 1..306 17..322 1530 100 Plus
CG9921-RB 309 CG9921-PB 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-RC 985 CG9921-RC 392..701 13..322 1535 99.7 Plus
CG9921-RB 685 CG9921-RB 92..401 13..322 1535 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16331565..16331726 322..161 810 100 Minus
X 23542271 X 16331808..16331957 162..13 735 99.3 Minus
Blast to na_te.dros performed on 2014-11-27 16:54:20 has no hits.

BO12031.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:54:56 Download gff for BO12031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 1..309 17..326 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:27:15 Download gff for BO12031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 186..506 6..329 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:55:52 Download gff for BO12031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 96..395 17..316 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:54:56 Download gff for BO12031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RA 186..506 6..329 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:48 Download gff for BO12031.complete
Subject Subject Range Query Range Percent Splice Strand
CG9921-RB 96..395 17..316 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:29:48 Download gff for BO12031.complete
Subject Subject Range Query Range Percent Splice Strand
X 16331571..16331725 162..316 100 <- Minus
X 16331809..16331953 17..161 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:55:52 Download gff for BO12031.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16225604..16225758 162..316 100 <- Minus
arm_X 16225842..16225986 17..161 100   Minus

BO12031.pep Sequence

Translation from 16 to 340

> BO12031.pep
MSNKIEVSLPEEELDWIQLRQDLGPVAEVETTKEKLQRKIKENPLVPLGC
LATTAALTAGLYNFRTGNRKMSQLMMRSRIAAQGFTVMALVVGVVMTYTD
KKASFLDH

BO12031.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9921-PC 102 CG9921-PC 1..102 1..102 510 100 Plus
CG9921-PB 102 CG9921-PB 1..102 1..102 510 100 Plus