Clone BO12196 Report

Search the DGRC for BO12196

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:121
Well:96
Vector:pDNR-Dual
Associated Gene/Transcriptl(2)06225-RA
Protein status:BO12196.pep: validated full length
Sequenced Size:331

Clone Sequence Records

BO12196.3prime Sequence

329 bp (328 high quality bases) assembled on 2006-04-20

> BO12196.3prime
ATGGTCTAGAAAGCTTGCGACATTGTAGCCTACAATGTGACGCTTGCCGA
TGCACTCGCCGATGTAGAACCAGAAGATGACCTCGGCGGTCACCAGGGTG
TTAAGCCAGGCCTCGCGAACCGTGAGGTTCTTGTAGGCGCCGGTCTTGGC
TCCCTTGATGATGTTGCCCAGTCCTTGGCGAATGGCCGGAATATCGGCGG
GCGTCGGGGGCGTCAGTTCCACCTTGGCGTACTTCAGGAACACGTCCAGT
TGGGGCCTCGCCTGTGTGAGGAGCCTGTTCACAAGTCCTGATCCCTTGGT
AGCCAAACTCGCCATGTCGACTGATAACT

BO12196.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6105-PA 300 l(2)06225-RA 1..297 315..19 1485 100 Minus
CG6105-PB 300 l(2)06225-RB 1..297 315..19 1485 100 Minus
CG6105-PC 300 l(2)06225-RC 1..297 315..19 1485 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 733 CG6105-RD 54..361 315..7 1490 99 Minus
l(2)06225-RB 477 CG6105-RB 54..361 315..7 1490 99 Minus
l(2)06225-RA 497 CG6105-RA 74..381 315..7 1490 99 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 12:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975905..10976161 19..275 1285 100 Plus
2L 23513712 2L 10976250..10976290 275..315 205 100 Plus
Blast to na_te.dros performed on 2015-01-31 12:33:14 has no hits.

BO12196.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:29:04 Download gff for BO12196.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6105-PA 1..300 15..315 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:02:01 Download gff for BO12196.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6105-PC 1..300 15..315 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-07 00:01:23 Download gff for BO12196.3prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 7..315 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 13:05:54 Download gff for BO12196.3prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 7..315 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 13:05:54 Download gff for BO12196.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 10975894..10976161 7..275 98 <- Plus
2L 10976251..10976290 276..315 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-07 00:01:23 Download gff for BO12196.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10975894..10976161 7..275 98 <- Plus
arm_2L 10976251..10976290 276..315 100   Plus

BO12196.5prime Sequence

329 bp (328 high quality bases) assembled on 2006-04-20

> BO12196.5prime
GAAGTTATCAGTCGACATGGCGAGTTTGGCTACCAAGGGATCAGGACTTG
TGAACAGGCTCCTCACACAGGCGAGGCCCCAACTGGACGTGTTCCTGAAG
TACGCCAAGGTGGAACTGACGCCCCCGACGCCCGCCGATATTCCGGCCAT
TCGCCAAGGACTGGGCAACATCATCAAGGGAGCCAAGACCGGCGCCTACA
AGAACCTCACGGTTCGCGAGGCCTGGCTTAACACCCTGGTGACCGCCGAG
GTCATCTTCTGGTTCTACATCGGCGAGTGCATCGGCAAGCGTCACATTGT
AGGCTACAATGTCGCAAGCTTTCTAGACC

BO12196.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG6105-PA 300 l(2)06225-RA 1..297 17..313 1485 100 Plus
CG6105-PB 300 l(2)06225-RB 1..297 17..313 1485 100 Plus
CG6105-PC 300 l(2)06225-RC 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 14:14:13
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 733 CG6105-RD 54..361 17..325 1490 99 Plus
l(2)06225-RB 477 CG6105-RB 54..361 17..325 1490 99 Plus
l(2)06225-RA 497 CG6105-RA 74..381 17..325 1490 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 14:14:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975905..10976161 313..57 1285 100 Minus
2L 23513712 2L 10976250..10976290 57..17 205 100 Minus
Blast to na_te.dros performed on 2015-02-13 14:14:12 has no hits.

BO12196.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:29:05 Download gff for BO12196.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6105-PA 1..300 17..317 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:02:03 Download gff for BO12196.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6105-PC 1..300 17..317 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-03 03:03:22 Download gff for BO12196.5prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 17..325 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 16:02:20 Download gff for BO12196.5prime
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..381 17..325 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 16:02:20 Download gff for BO12196.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 10975894..10976161 57..325 98 <- Minus
2L 10976251..10976290 17..56 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-03 03:03:22 Download gff for BO12196.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10975894..10976161 57..325 98 <- Minus
arm_2L 10976251..10976290 17..56 100   Minus

BO12196.complete Sequence

331 bp assembled on 2006-10-11

GenBank Submission: FJ632354

> BO12196.complete
GAAGTTATCAGTCGACATGGCGAGTTTGGCTACCAAGGGATCAGGACTTG
TGAACAGGCTCCTCACACAGGCGAGGCCCCAACTGGACGTGTTCCTGAAG
TACGCCAAGGTGGAACTGACGCCCCCGACGCCCGCCGATATTCCGGCCAT
TCGCCAAGGACTGGGCAACATCATCAAGGGAGCCAAGACCGGCGCCTACA
AGAACCTCACGGTTCGCGAGGCCTGGCTTAACACCCTGGTGACCGCCGAG
GTCATCTTCTGGTTCTACATCGGCGAGTGCATCGGCAAGCGTCACATTGT
AGGCTACAATGTCGCAAGCTTTCTAGACCAT

BO12196.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 300 CG6105-PD 1..297 17..313 1485 100 Plus
l(2)06225-RB 300 CG6105-PB 1..297 17..313 1485 100 Plus
l(2)06225-RA 300 CG6105-PA 1..297 17..313 1485 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RD 733 CG6105-RD 54..350 17..313 1485 100 Plus
l(2)06225-RB 477 CG6105-RB 54..350 17..313 1485 100 Plus
l(2)06225-RA 497 CG6105-RA 74..370 17..313 1485 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975905..10976161 313..57 1285 100 Minus
2L 23513712 2L 10976250..10976290 57..17 205 100 Minus
Blast to na_te.dros performed on 2014-11-27 16:50:01 has no hits.

BO12196.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:59:19 Download gff for BO12196.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 1..300 17..317 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:31:22 Download gff for BO12196.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 434..741 17..325 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:55:18 Download gff for BO12196.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..370 17..315 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:59:19 Download gff for BO12196.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 434..741 17..325 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:28:05 Download gff for BO12196.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 74..370 17..315 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:28:05 Download gff for BO12196.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10976251..10976290 17..56 100   Minus
2L 10975903..10976161 57..315 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:55:18 Download gff for BO12196.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10975903..10976161 57..315 99 <- Minus
arm_2L 10976251..10976290 17..56 100   Minus

BO12196.pep Sequence

Translation from 16 to 331

> BO12196.pep
MASLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLG
NIIKGAKTGAYKNLTVREAWLNTLVTAEVIFWFYIGECIGKRHIVGYNVA
SFLDH

BO12196.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-PD 99 CG6105-PD 1..99 1..99 512 100 Plus
l(2)06225-PB 99 CG6105-PB 1..99 1..99 512 100 Plus
l(2)06225-PA 99 CG6105-PA 1..99 1..99 512 100 Plus
CG7211-PA 107 CG7211-PA 1..107 1..99 261 51.4 Plus