Clone BO12248 Report

Search the DGRC for BO12248

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:122
Well:48
Vector:pDNR-Dual
Associated Gene/Transcriptl(1)G0230-RA
Protein status:BO12248.pep: validated full length
Sequenced Size:505

Clone Sequence Records

BO12248.5prime Sequence

503 bp (502 high quality bases) assembled on 2006-04-20

> BO12248.5prime
GAAGTTATCAGTCGACATGTCCTTCGTTAAGAACGCCCGTTTGCTGGCCG
CCCGCGGCGCTCGCTTGGCCCAGAACCGCAGCTACTCGGATGAGATGAAG
CTGACCTTCGCCGCCGCCAACAAAACCTTCTACGATGCCGCTGTGGTGCG
CCAAATCGATGTGCCTTCCTTCTCGGGATCCTTCGGCATCCTGGCCAAGC
ACGTGCCCACTCTGGCTGTCCTGAAGCCCGGCGTTGTCCAGGTGGTGGAA
AACGATGGCAAGACCCTCAAGTTCTTCGTCTCCAGCGGTTCCGTCACCGT
CAACGAGGATTCCTCCGTTCAGGTTCTGGCCGAGGAGGCCCACAACATCG
AGGACATCGATGCCAATGAGGCGCGCCAGCTGCTCGCGAAATACCAGTCA
CAGCTTAGCTCCGCTGGCGACGACAAGGCCAAGGCCCAGGCTGCCATTGC
CGTGGAGGTCGCCGAAGCGTTAGTCAAGGCTGCCGAAGCAAGCTTTCTAG
ACC

BO12248.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:40:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG2968-PA 474 l(1)G0230-RA 1..471 17..487 2355 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:20:58
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0230-RC 3817 CG2968-RC 112..582 17..487 2355 100 Plus
l(1)G0230-RB 978 CG2968-RB 112..582 17..487 2355 100 Plus
l(1)G0230-RA 666 CG2968-RA 112..582 17..487 2355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:20:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10213559..10213772 215..428 1070 100 Plus
X 23542271 X 10213287..10213485 17..215 995 100 Plus
X 23542271 X 10214097..10214158 426..487 310 100 Plus
Blast to na_te.dros performed on 2015-02-12 11:20:56 has no hits.

BO12248.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:30:30 Download gff for BO12248.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2968-PA 1..474 17..488 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:04:02 Download gff for BO12248.5prime
Subject Subject Range Query Range Percent Splice Strand
CG2968-PA 1..474 17..488 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 05:22:24 Download gff for BO12248.5prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 103..582 9..487 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:28:30 Download gff for BO12248.5prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 103..582 9..487 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:28:30 Download gff for BO12248.5prime
Subject Subject Range Query Range Percent Splice Strand
X 10213278..10213485 9..215 98 -> Plus
X 10213560..10213771 216..427 100 -> Plus
X 10214099..10214158 428..487 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 05:22:24 Download gff for BO12248.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 10107311..10107518 9..215 98 -> Plus
arm_X 10107593..10107804 216..427 100 -> Plus
arm_X 10108132..10108191 428..487 100   Plus

BO12248.complete Sequence

505 bp assembled on 2007-10-29

GenBank Submission: FJ632378

> BO12248.complete
GAAGTTATCAGTCGACATGTCCTTCGTTAAGAACGCCCGTTTGCTGGCCG
CCCGCGGCGCTCGCTTGGCCCAGAACCGCAGCTACTCGGATGAGATGAAG
CTGACCTTCGCCGCCGCCAACAAAACCTTCTACGATGCCGCTGTGGTGCG
CCAAATCGATGTGCCTTCCTTCTCGGGATCCTTCGGCATCCTGGCCAAGC
ACGTGCCCACTCTGGCTGTCCTGAAGCCCGGCGTTGTCCAGGTGGTGGAA
AACGATGGCAAGACCCTCAAGTTCTTCGTCTCCAGCGGTTCCGTCACCGT
CAACGAGGATTCCTCCGTTCAGGTTCTGGCCGAGGAGGCCCACAACATCG
AGGACATCGATGCCAATGAGGCGCGCCAGCTGCTCGCGAAATACCAGTCA
CAGCTTAGCTCCGCTGGCGACGACAAGGCCAAGGCCCAGGCTGCCATTGC
CGTGGAGGTCGCCGAAGCGTTAGTCAAGGCTGCCGAAGCAAGCTTTCTAG
ACCAT

BO12248.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0230-RC 474 CG2968-PC 1..471 17..487 2355 100 Plus
l(1)G0230-RB 474 CG2968-PB 1..471 17..487 2355 100 Plus
l(1)G0230-RA 474 CG2968-PA 1..471 17..487 2355 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0230-RC 3817 CG2968-RC 112..582 17..487 2355 100 Plus
l(1)G0230-RB 978 CG2968-RB 112..582 17..487 2355 100 Plus
l(1)G0230-RA 666 CG2968-RA 112..582 17..487 2355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10213559..10213772 215..428 1070 100 Plus
X 23542271 X 10213287..10213485 17..215 995 100 Plus
X 23542271 X 10214097..10214158 426..487 310 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:00:02 has no hits.

BO12248.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:00:08 Download gff for BO12248.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..474 17..488 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:01:08 Download gff for BO12248.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 101..580 9..487 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:47:42 Download gff for BO12248.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 112..582 17..489 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 16:44:45 Download gff for BO12248.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 110..580 17..489 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:08:57 Download gff for BO12248.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 112..582 17..489 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:08:57 Download gff for BO12248.complete
Subject Subject Range Query Range Percent Splice Strand
X 10213287..10213485 17..215 100 -> Plus
X 10213560..10213771 216..427 100 -> Plus
X 10214099..10214158 428..489 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:47:42 Download gff for BO12248.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10107320..10107518 17..215 100 -> Plus
arm_X 10107593..10107804 216..427 100 -> Plus
arm_X 10108132..10108191 428..489 96   Plus

BO12248.pep Sequence

Translation from 16 to 505

> BO12248.pep
MSFVKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVP
SFSGSFGILAKHVPTLAVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSS
VQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAVEVAE
ALVKAAEASFLDH

BO12248.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0230-PC 157 CG2968-PC 1..157 1..157 756 100 Plus
l(1)G0230-PB 157 CG2968-PB 1..157 1..157 756 100 Plus
l(1)G0230-PA 157 CG2968-PA 1..157 1..157 756 100 Plus