Clone BO12532 Report

Search the DGRC for BO12532

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:125
Well:32
Vector:pDNR-Dual
Associated Gene/TranscriptCG14229-RA
Protein status:BO12532.pep: validated full length
Sequenced Size:352

Clone Sequence Records

BO12532.3prime Sequence

350 bp (349 high quality bases) assembled on 2006-05-08

> BO12532.3prime
ATGGTCTAGAAAGCTTGCCTGGCTGCTCCGCTTGATGCGCTCGACATGCA
GGTCGTACAGCATCTTGTTCTTCTCGTAGTAAAATGGGTTTTGTTCGGCT
CCCAGTTCTGGGTTGTATTCGTATCCGGCCGCCACACCGTTTCCGGCTGC
ATCGGACCCGCCGGATCCACCAGTCGCTCCTCCTCCCGACAGTGGCGGAA
TGCTGCAGCTGCTGCTGCTGCTGCTGTTCCCATCCTCGTAGTTCAGATTC
AGGTTGTTGATGCGCTTCGAAAGGGGCGACTCGCAGGCCAGTTCATCCTC
CCGGCTGCGCTTTCTTGTCTTCAGGAATCCAGCCATGTCGACTGATAACT

BO12532.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PA 321 CG14229-RA 1..318 336..19 1590 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 1018 CG14229-RB 108..425 336..19 1590 100 Minus
CG14229-RC 989 CG14229-RC 300..617 336..19 1590 100 Minus
CG14229-RA 797 CG14229-RA 108..425 336..19 1590 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19694570..19694866 19..315 1485 100 Plus
Blast to na_te.dros performed on 2015-02-10 15:23:51 has no hits.

BO12532.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:38:28 Download gff for BO12532.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-PA 1..321 18..336 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:15:13 Download gff for BO12532.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-PA 1..321 18..336 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 21:29:00 Download gff for BO12532.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..430 12..346 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:51:58 Download gff for BO12532.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..430 12..346 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 17:51:58 Download gff for BO12532.3prime
Subject Subject Range Query Range Percent Splice Strand
X 19694565..19694864 12..313 99 <- Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 21:29:00 Download gff for BO12532.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19588598..19588897 12..313 99 <- Plus

BO12532.5prime Sequence

350 bp (349 high quality bases) assembled on 2006-05-08

> BO12532.5prime
GAAGTTATCAGTCGACATGGCTGGATTCCTGAAGACAAGAAAGCGCAGCC
GGGAGGATGAACTGGCCTGCGAGTCGCCCCTTTCGAAGCGCATCAACAAC
CTGAATCTGAACTACGAGGATGGGAACAGCAGCAGCAGCAGCAGCTGCAG
CATTCCGCCACTGTCGGGAGGAGGAGCGACTGGTGGATCCGGCGGGTCCG
ATGCAGCCGGAAACGGTGTGGCGGCCGGATACGAATACAACCCAGAACTG
GGAGCCGAACAAAACCCATTTTACTACGAGAAGAACAAGATGCTGTACGA
CCTGCATGTCGAGCGCATCAAGCGGAGCAGCCAGGCAAGCTTTCTAGACC

BO12532.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PA 321 CG14229-RA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 1018 CG14229-RB 108..425 17..334 1590 100 Plus
CG14229-RC 989 CG14229-RC 300..617 17..334 1590 100 Plus
CG14229-RA 797 CG14229-RA 108..425 17..334 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19694570..19694866 334..38 1485 100 Minus
Blast to na_te.dros performed on 2015-02-11 10:07:11 has no hits.

BO12532.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:38:29 Download gff for BO12532.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-PA 1..321 17..335 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:15:15 Download gff for BO12532.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-PA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 01:52:08 Download gff for BO12532.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..430 7..341 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:08:09 Download gff for BO12532.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 102..430 7..341 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:08:09 Download gff for BO12532.5prime
Subject Subject Range Query Range Percent Splice Strand
X 19694565..19694864 40..341 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 01:52:08 Download gff for BO12532.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 19588598..19588897 40..341 99 <- Minus

BO12532.complete Sequence

352 bp assembled on 2006-10-11

GenBank Submission: FJ632476

> BO12532.complete
GAAGTTATCAGTCGACATGGCTGGATTCCTGAAGACAAGAAAGCGCAGCC
GGGAGGATGAACTGGCCTGCGAGTCGCCCCTTTCGAAGCGCATCAACAAC
CTGAATCTGAACTACGAGGATGGGAACAGCAGCAGCAGCAGCAGCTGCAG
CATTCCGCCACTGTCGGGAGGAGGAGCGACTGGTGGATCCGGCGGGTCCG
ATGCAGCCGGAAACGGTGTGGCGGCCGGATACGAATACAACCCAGAACTG
GGAGCCGAACAAAACCCATTTTACTACGAGAAGAACAAGATGCTGTACGA
CCTGCATGTCGAGCGCATCAAGCGGAGCAGCCAGGCAAGCTTTCTAGACC
AT

BO12532.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:14:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 321 CG14229-PB 1..318 17..334 1590 100 Plus
CG14229-RC 321 CG14229-PC 1..318 17..334 1590 100 Plus
CG14229-RA 321 CG14229-PA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-RB 1018 CG14229-RB 108..425 17..334 1590 100 Plus
CG14229-RC 989 CG14229-RC 300..617 17..334 1590 100 Plus
CG14229-RA 797 CG14229-RA 108..425 17..334 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19694570..19694866 334..38 1485 100 Minus
Blast to na_te.dros performed on 2014-11-28 01:14:21 has no hits.

BO12532.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:38:37 Download gff for BO12532.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:00:41 Download gff for BO12532.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 85..413 7..341 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:43:25 Download gff for BO12532.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 108..425 17..336 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:38:38 Download gff for BO12532.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 85..413 7..341 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:48:30 Download gff for BO12532.complete
Subject Subject Range Query Range Percent Splice Strand
CG14229-RA 108..425 17..336 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:48:30 Download gff for BO12532.complete
Subject Subject Range Query Range Percent Splice Strand
X 19694566..19694864 40..336 99 <- Minus
X 19694929..19694951 17..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:43:25 Download gff for BO12532.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19588599..19588897 40..336 99 <- Minus
arm_X 19588962..19588984 17..39 100   Minus

BO12532.pep Sequence

Translation from 16 to 352

> BO12532.pep
MAGFLKTRKRSREDELACESPLSKRINNLNLNYEDGNSSSSSSCSIPPLS
GGGATGGSGGSDAAGNGVAAGYEYNPELGAEQNPFYYEKNKMLYDLHVER
IKRSSQASFLDH

BO12532.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14229-PB 106 CG14229-PB 1..106 1..106 554 100 Plus
CG14229-PC 106 CG14229-PC 1..106 1..106 554 100 Plus
CG14229-PA 106 CG14229-PA 1..106 1..106 554 100 Plus