Clone BO12637 Report

Search the DGRC for BO12637

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:126
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG31337-RA
Protein status:BO12637.pep:
Sequenced Size:346

Clone Sequence Records

BO12637.5prime Sequence

344 bp (343 high quality bases) assembled on 2006-05-08

> BO12637.5prime
GAAGTTATCAGTCGACATGCGGCGCGCATCTCGATTGATTCCGTTCGGTT
TCGTCATCCTGCTCCTGATTCTTCTGCTCCTCCAGCCATCGACAGACGGC
CACACACTGGGCGCCAGCTGCCAGACGCCCGAGAAGAGCGAAGGACGCTG
TGTGCACTTCAGCTCCTGCCGGCTCGTCTTGCGTCACTATGCGATGTACA
AGGAGCACATGCCGCCAGCGATAATGCGATTCCTGCAGAGGGTCCGTTGC
AAGCCGAAACGCGAAGGCTATCATTTGTGCTGCGAACTCAAAGATGTGAT
TCCCGCGAACGCCAACTCCAAGTTGAAGGCAAGCTTTCTAGACC

BO12637.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-PA 315 CG31337-RA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 849 CG31337-RA 186..497 17..328 1560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 16:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13544546..13544706 268..108 805 100 Minus
3R 32079331 3R 13545125..13545215 107..17 455 100 Minus
3R 32079331 3R 13544318..13544377 328..269 300 100 Minus
Blast to na_te.dros performed on 2015-02-11 16:59:58 has no hits.

BO12637.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:41:27 Download gff for BO12637.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-PA 1..315 17..332 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:19:14 Download gff for BO12637.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-PA 1..315 17..332 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 14:08:49 Download gff for BO12637.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 165..484 12..332 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:56:24 Download gff for BO12637.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 181..500 12..332 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 18:56:24 Download gff for BO12637.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13544314..13544377 269..332 96 <- Minus
3R 13544546..13544706 108..268 100 <- Minus
3R 13545125..13545220 12..107 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 14:08:49 Download gff for BO12637.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9370847..9370942 12..107 97   Minus
arm_3R 9370268..9370428 108..268 100 <- Minus
arm_3R 9370036..9370099 269..332 96 <- Minus

BO12637.3prime Sequence

344 bp (343 high quality bases) assembled on 2006-05-08

> BO12637.3prime
ATGGTCTAGAAAGCTTGCCTTCCACTTGGAGTTGGCGTTCGCGGGAATCA
CATCTTTGAGTTCGCAGCACAAATGATAGCCTTCGCGTTTCGGCTTGCAA
CGGACCCTCTGCAGGAATCGCATTATCGCTGGCGGCATGTGCTCCTTGTA
CATCGCATAGTGACGCAAGACGAGCCGGCAGGAGCTGAAGTGCACACAGC
GTCCTTCGCTCTTCTCGGGCGTCTGGCAGCTGGCGCCCAGTGTGTGGCCG
TCTGTCGATGGCTGGAGGAGCAGAAGAATCAGGAGCAGGATGACGAAACC
GAACGGAATCAATCGAGATGCGCGCCGCATGTCGACTGATAACT

BO12637.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-PA 315 CG31337-RA 1..307 330..24 1535 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:26:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 849 CG31337-RA 186..497 330..19 1545 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 07:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13544546..13544706 79..239 805 100 Plus
3R 32079331 3R 13545125..13545215 240..330 455 100 Plus
3R 32079331 3R 13544318..13544377 19..78 285 98.3 Plus
Blast to na_te.dros performed on 2015-02-03 07:26:39 has no hits.

BO12637.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:41:26 Download gff for BO12637.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-PA 1..315 15..330 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:19:12 Download gff for BO12637.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-PA 1..315 15..330 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:30:48 Download gff for BO12637.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 165..484 15..335 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 09:46:04 Download gff for BO12637.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 181..500 15..335 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 09:46:04 Download gff for BO12637.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 13544314..13544377 15..78 95 <- Plus
3R 13544546..13544706 79..239 100 <- Plus
3R 13545125..13545220 240..335 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:30:48 Download gff for BO12637.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9370036..9370099 15..78 95 <- Plus
arm_3R 9370268..9370428 79..239 100 <- Plus
arm_3R 9370847..9370942 240..335 97   Plus

BO12637.complete Sequence

346 bp assembled on 2007-06-22

GenBank Submission: FJ632510

> BO12637.complete
GAAGTTATCAGTCGACATGCGGCGCGCATCTCGATTGATTCCGTTCGGTT
TCGTCATCCTGCTCCTGATTCTTCTGCTCCTCCAGCCATCGACAGACGGC
CACACACTGGGCGCCAGCTGCCAGACGCCCGAGAAGAGCGAAGGACGCTG
TGTGCACTTCAGCTCCTGCCGGCTCGTCTTGCGTCACTATGCGATGTACA
AGGAGCACATGCCGCCAGCGATAATGCGATTCCTGCAGAGGGTCCGTTGC
AAGCCGAAACGCGAAGGCTATCATTTGTGCTGCGAACTCAAAGATGTGAT
TCCCGCGAACGCCAACTCCAAGTTGAAGGCAAGCTTTCTAGACCAT

BO12637.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 315 CG31337-PA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-RA 849 CG31337-RA 186..497 17..328 1560 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13544546..13544706 268..108 805 100 Minus
3R 32079331 3R 13545125..13545215 107..17 455 100 Minus
3R 32079331 3R 13544318..13544377 328..269 300 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:36:43 has no hits.

BO12637.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:36:19 Download gff for BO12637.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 1..315 17..332 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 04:57:28 Download gff for BO12637.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 165..484 12..332 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:13 Download gff for BO12637.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 170..481 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:36:19 Download gff for BO12637.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 165..484 12..332 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:01:37 Download gff for BO12637.complete
Subject Subject Range Query Range Percent Splice Strand
CG31337-RA 186..497 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:01:37 Download gff for BO12637.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13545125..13545215 17..107 100   Minus
3R 13544316..13544377 269..330 96 <- Minus
3R 13544546..13544706 108..268 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:13 Download gff for BO12637.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9370847..9370937 17..107 100   Minus
arm_3R 9370038..9370099 269..330 96 <- Minus
arm_3R 9370268..9370428 108..268 100 <- Minus

BO12637.pep Sequence

Translation from 16 to 346

> BO12637.pep
MRRASRLIPFGFVILLLILLLLQPSTDGHTLGASCQTPEKSEGRCVHFSS
CRLVLRHYAMYKEHMPPAIMRFLQRVRCKPKREGYHLCCELKDVIPANAN
SKLKASFLDH

BO12637.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG31337-PA 104 CG31337-PA 1..104 1..104 554 100 Plus