Clone BO12755 Report

Search the DGRC for BO12755

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:127
Well:55
Vector:pDNR-Dual
Associated Gene/TranscriptCG30080-RA
Protein status:BO12755.pep: validated full length
Sequenced Size:382

Clone Sequence Records

BO12755.3prime Sequence

380 bp (379 high quality bases) assembled on 2006-05-09

> BO12755.3prime
ATGGTCTAGAAAGCTTGCAATGGTTTGGTTATCTACGCTGAGGGCATCCA
CTAACTGGGAAATTCGTTGAGCTCGCGTCAATTTCCACGATACGCAGGAC
AAAGCCGTGATGAAGAAGCCAATCGCCATTAGGAGAATGGCCTCGGAAGT
CTCATCCTGCCAGGCTTTTGAGACAACGCACAGTAAAATGAATCCGCTGA
GCAGGCAAAAGGATCCAACTACGACGGCCAGTGTTATGAGTATGATCACC
GGATCGTTTAGAGGACCATAATCAAAGAGTGTACGGCAGAGGGACGTTTT
CCGGGGCATAGGAGTACCACAGGCTTGAGAATAGGTGGGTAGAATGGGAA
CAGCTCTGCACTCCATGTCGACTGATAACT

BO12755.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG30080-PA 351 CG30080-RA 1..348 366..19 1740 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 10:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-RC 1695 CG42662-RC 21..369 367..19 1745 100 Minus
CG42662-RB 2791 CG42662-RB 21..369 367..19 1745 100 Minus
CG30080-RC 1695 CG30080-RC 21..369 367..19 1745 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 10:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15701379..15701573 126..320 975 100 Plus
2R 25286936 2R 15701217..15701324 19..126 540 100 Plus
2R 25286936 2R 15701629..15701676 320..367 240 100 Plus
Blast to na_te.dros performed on 2015-02-11 10:05:06 has no hits.

BO12755.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:44:56 Download gff for BO12755.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30080-PA 1..351 18..366 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:23:56 Download gff for BO12755.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30080-PA 1..351 18..366 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-24 04:58:43 Download gff for BO12755.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42662-RC 11..375 11..378 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 12:02:59 Download gff for BO12755.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30080-RC 11..375 11..378 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 12:02:59 Download gff for BO12755.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 15701211..15701323 11..125 97 <- Plus
2R 15701379..15701572 126..319 100 <- Plus
2R 15701629..15701686 320..378 93   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-24 04:58:43 Download gff for BO12755.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11588716..11588828 11..125 97 <- Plus
arm_2R 11588884..11589077 126..319 100 <- Plus
arm_2R 11589134..11589191 320..378 93   Plus

BO12755.5prime Sequence

380 bp (379 high quality bases) assembled on 2006-05-08

> BO12755.5prime
GAAGTTATCAGTCGACATGGAGTGCAGAGCTGTTCCCATTCTACCCACCT
ATTCTCAAGCCTGTGGTACTCCTATGCCCCGGAAAACGTCCCTCTGCCGT
ACACTCTTTGATTATGGTCCTCTAAACGATCCGGTGATCATACTCATAAC
ACTGGCCGTCGTAGTTGGATCCTTTTGCCTGCTCAGCGGATTCATTTTAC
TGTGCGTTGTCTCAAAAGCCTGGCAGGATGAGACTTCCGAGGCCATTCTC
CTAATGGCGATTGGCTTCTTCATCACGGCTTTGTCCTGCGTATCGTGGAA
ATTGACGCGAGCTCAACGAATTTCCCAGTTAGTGGATGCCCTCAGCGTAG
ATAACCAAACCATTGCAAGCTTTCTAGACC

BO12755.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG30080-PA 351 CG30080-RA 1..348 17..364 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 09:15:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-RC 1695 CG42662-RC 21..369 16..364 1745 100 Plus
CG42662-RB 2791 CG42662-RB 21..369 16..364 1745 100 Plus
CG30080-RC 1695 CG30080-RC 21..369 16..364 1745 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 09:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15701379..15701573 257..63 975 100 Minus
2R 25286936 2R 15701217..15701324 364..257 540 100 Minus
2R 25286936 2R 15701629..15701676 63..16 240 100 Minus
Blast to na_te.dros performed on 2015-02-09 09:15:25 has no hits.

BO12755.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:44:57 Download gff for BO12755.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30080-PA 1..351 17..365 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:23:58 Download gff for BO12755.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30080-PA 1..351 17..365 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-12 18:17:25 Download gff for BO12755.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42662-RC 11..375 5..372 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 11:47:41 Download gff for BO12755.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30080-RC 11..375 5..372 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 11:47:41 Download gff for BO12755.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 15701211..15701323 258..372 97 <- Minus
2R 15701379..15701572 64..257 100 <- Minus
2R 15701629..15701686 5..63 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-12 18:17:25 Download gff for BO12755.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11588716..11588828 258..372 97 <- Minus
arm_2R 11588884..11589077 64..257 100 <- Minus
arm_2R 11589134..11589191 5..63 93   Minus

BO12755.complete Sequence

382 bp assembled on 2006-10-11

GenBank Submission: FJ632551

> BO12755.complete
GAAGTTATCAGTCGACATGGAGTGCAGAGCTGTTCCCATTCTACCCACCT
ATTCTCAAGCCTGTGGTACTCCTATGCCCCGGAAAACGTCCCTCTGCCGT
ACACTCTTTGATTATGGTCCTCTAAACGATCCGGTGATCATACTCATAAC
ACTGGCCGTCGTAGTTGGATCCTTTTGCCTGCTCAGCGGATTCATTTTAC
TGTGCGTTGTCTCAAAAGCCTGGCAGGATGAGACTTCCGAGGCCATTCTC
CTAATGGCGATTGGCTTCTTCATCACGGCTTTGTCCTGCGTATCGTGGAA
ATTGACGCGAGCTCAACGAATTTCCCAGTTAGTGGATGCCCTCAGCGTAG
ATAACCAAACCATTGCAAGCTTTCTAGACCAT

BO12755.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG30080-RC 351 CG30080-PC 1..348 17..364 1740 100 Plus
CG30080-RA 351 CG30080-PA 1..348 17..364 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42662-RC 1695 CG42662-RC 21..369 16..364 1745 100 Plus
CG42662-RB 2791 CG42662-RB 21..369 16..364 1745 100 Plus
CG30080-RC 1695 CG30080-RC 21..369 16..364 1745 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15701379..15701573 257..63 975 100 Minus
2R 25286936 2R 15701217..15701324 364..257 540 100 Minus
2R 25286936 2R 15701629..15701676 63..16 240 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:06:26 has no hits.

BO12755.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:59:03 Download gff for BO12755.complete
Subject Subject Range Query Range Percent Splice Strand
CG30080-RA 1..351 17..365 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:31:07 Download gff for BO12755.complete
Subject Subject Range Query Range Percent Splice Strand
CG30080-RA 9..373 5..372 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:48 Download gff for BO12755.complete
Subject Subject Range Query Range Percent Splice Strand
CG42662-RC 22..369 17..366 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:59:03 Download gff for BO12755.complete
Subject Subject Range Query Range Percent Splice Strand
CG30080-RA 9..373 5..372 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:03:26 Download gff for BO12755.complete
Subject Subject Range Query Range Percent Splice Strand
CG30080-RC 22..369 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:03:26 Download gff for BO12755.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15701213..15701323 258..366 98 <- Minus
2R 15701379..15701572 64..257 100 <- Minus
2R 15701629..15701675 17..63 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:48 Download gff for BO12755.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11588884..11589077 64..257 100 <- Minus
arm_2R 11589134..11589180 17..63 100   Minus
arm_2R 11588718..11588828 258..366 98 <- Minus

BO12755.pep Sequence

Translation from 16 to 382

> BO12755.pep
MECRAVPILPTYSQACGTPMPRKTSLCRTLFDYGPLNDPVIILITLAVVV
GSFCLLSGFILLCVVSKAWQDETSEAILLMAIGFFITALSCVSWKLTRAQ
RISQLVDALSVDNQTIASFLDH

BO12755.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:19:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG30080-PC 116 CG30080-PC 1..116 1..116 594 100 Plus
CG30080-PA 116 CG30080-PA 1..116 1..116 594 100 Plus