Clone BO12774 Report

Search the DGRC for BO12774

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:127
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptCG31715-RA
Protein status:BO12774.pep: validated full length
Sequenced Size:397

Clone Sequence Records

BO12774.3prime Sequence

395 bp (394 high quality bases) assembled on 2006-05-09

> BO12774.3prime
ATGGTCTAGAAAGCTTGCTGCAAGGAGTTTCTTAATCTCGTCTTTTTCCG
CCGCCTCGAGGTAGCTTTGGCCATCTGGAGTAGAACCATTTTTATCAGCT
CCCATTTTTAGAAGTAATTCCACACAGCTCGTATGTCCTTCCCAAATGGC
AGCCAGAATGGGGGTAATACCATGTTTGTCCTTTCTATTTATGTCTGCTC
CTAAGCTTATAAGAAACTCCAGGACATTCAGTTGTCCAAAATCTGCTGCA
TAGTGTACTGGAAAACGGCCCTTGATTTCCTCATTCACCTTTTGTGCATC
ATTCTGAAAAGCGTCTTGCACAGCATCGAACTCTCCGTTCTTTATGGTCC
AAATAATGTCTTCATTAGAAATCGCACTCATGTCGACTGATAACT

BO12774.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-PA 366 CG31715-RA 1..363 381..19 1815 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-06 12:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-RA 580 CG31715-RA 67..429 381..19 1815 100 Minus
CG31715-RB 574 CG31715-RB 67..423 381..19 1715 98.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-06 12:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10341822..10341932 297..187 555 100 Minus
2L 23513712 2L 10341682..10341766 381..297 425 100 Minus
2L 23513712 2L 10342150..10342234 186..102 425 100 Minus
2L 23513712 2L 10342288..10342372 103..19 425 100 Minus
Blast to na_te.dros performed on 2015-02-06 12:05:20 has no hits.

BO12774.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:45:31 Download gff for BO12774.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-PA 1..366 15..381 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:24:45 Download gff for BO12774.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-PA 1..366 15..381 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 06:57:23 Download gff for BO12774.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..432 15..381 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-06 13:38:27 Download gff for BO12774.3prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..432 15..381 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-06 13:38:27 Download gff for BO12774.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 10342289..10342375 15..102 97   Minus
2L 10341682..10341765 298..381 100 -> Minus
2L 10341822..10341932 187..297 100 -> Minus
2L 10342150..10342233 103..186 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 06:57:23 Download gff for BO12774.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10341682..10341765 298..381 100 -> Minus
arm_2L 10341822..10341932 187..297 100 -> Minus
arm_2L 10342150..10342233 103..186 100 -> Minus
arm_2L 10342289..10342375 15..102 97   Minus

BO12774.5prime Sequence

395 bp (394 high quality bases) assembled on 2006-05-08

> BO12774.5prime
GAAGTTATCAGTCGACATGAGTGCGATTTCTAATGAAGACATTATTTGGA
CCATAAAGAACGGAGAGTTCGATGCTGTGCAAGACGCTTTTCAGAATGAT
GCACAAAAGGTGAATGAGGAAATCAAGGGCCGTTTTCCAGTACACTATGC
AGCAGATTTTGGACAACTGAATGTCCTGGAGTTTCTTATAAGCTTAGGAG
CAGACATAAATAGAAAGGACAAACATGGTATTACCCCCATTCTGGCTGCC
ATTTGGGAAGGACATACGAGCTGTGTGGAATTACTTCTAAAAATGGGAGC
TGATAAAAATGGTTCTACTCCAGATGGCCAAAGCTACCTCGAGGCGGCGG
AAAAAGACGAGATTAAGAAACTCCTTGCAGCAAGCTTTCTAGACC

BO12774.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 14:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-PA 366 CG31715-RA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 10:24:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-RA 580 CG31715-RA 67..429 17..379 1815 100 Plus
CG31715-RB 574 CG31715-RB 67..423 17..379 1715 98.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 10:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10341822..10341932 101..211 555 100 Plus
2L 23513712 2L 10341682..10341766 17..101 425 100 Plus
2L 23513712 2L 10342150..10342234 212..296 425 100 Plus
2L 23513712 2L 10342288..10342372 295..379 425 100 Plus
Blast to na_te.dros performed on 2015-02-02 10:24:07 has no hits.

BO12774.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:45:32 Download gff for BO12774.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-PA 1..366 17..383 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:24:46 Download gff for BO12774.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-PA 1..366 17..383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 03:56:33 Download gff for BO12774.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..432 17..383 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 12:22:31 Download gff for BO12774.5prime
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..432 17..383 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 12:22:31 Download gff for BO12774.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 10341682..10341765 17..100 100 -> Plus
2L 10341822..10341932 101..211 100 -> Plus
2L 10342150..10342233 212..295 100 -> Plus
2L 10342289..10342375 296..383 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 03:56:33 Download gff for BO12774.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10341682..10341765 17..100 100 -> Plus
arm_2L 10341822..10341932 101..211 100 -> Plus
arm_2L 10342150..10342233 212..295 100 -> Plus
arm_2L 10342289..10342375 296..383 97   Plus

BO12774.complete Sequence

397 bp assembled on 2006-10-11

GenBank Submission: FJ632560

> BO12774.complete
GAAGTTATCAGTCGACATGAGTGCGATTTCTAATGAAGACATTATTTGGA
CCATAAAGAACGGAGAGTTCGATGCTGTGCAAGACGCTTTTCAGAATGAT
GCACAAAAGGTGAATGAGGAAATCAAGGGCCGTTTTCCAGTACACTATGC
AGCAGATTTTGGACAACTGAATGTCCTGGAGTTTCTTATAAGCTTAGGAG
CAGACATAAATAGAAAGGACAAACATGGTATTACCCCCATTCTGGCTGCC
ATTTGGGAAGGACATACGAGCTGTGTGGAATTACTTCTAAAAATGGGAGC
TGATAAAAATGGTTCTACTCCAGATGGCCAAAGCTACCTCGAGGCGGCGG
AAAAAGACGAGATTAAGAAACTCCTTGCAGCAAGCTTTCTAGACCAT

BO12774.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-RA 366 CG31715-PA 1..363 17..379 1815 100 Plus
CG31715-RB 360 CG31715-PB 1..357 17..379 1690 98.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-RA 580 CG31715-RA 67..429 17..379 1815 100 Plus
CG31715-RB 574 CG31715-RB 67..423 17..379 1690 98.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10341822..10341932 101..211 555 100 Plus
2L 23513712 2L 10341682..10341766 17..101 425 100 Plus
2L 23513712 2L 10342150..10342234 212..296 425 100 Plus
2L 23513712 2L 10342288..10342372 295..379 425 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:48:50 has no hits.

BO12774.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:37:20 Download gff for BO12774.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 1..366 17..383 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:10:34 Download gff for BO12774.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 62..427 17..383 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:55:07 Download gff for BO12774.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..429 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:37:20 Download gff for BO12774.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 62..427 17..383 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:55:02 Download gff for BO12774.complete
Subject Subject Range Query Range Percent Splice Strand
CG31715-RA 67..429 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:55:02 Download gff for BO12774.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10341682..10341765 17..100 100 -> Plus
2L 10341822..10341932 101..211 100 -> Plus
2L 10342150..10342233 212..295 100 -> Plus
2L 10342289..10342372 296..381 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:55:07 Download gff for BO12774.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10341682..10341765 17..100 100 -> Plus
arm_2L 10341822..10341932 101..211 100 -> Plus
arm_2L 10342150..10342233 212..295 100 -> Plus
arm_2L 10342289..10342372 296..381 97   Plus

BO12774.pep Sequence

Translation from 16 to 397

> BO12774.pep
MSAISNEDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQ
LNVLEFLISLGADINRKDKHGITPILAAIWEGHTSCVELLLKMGADKNGS
TPDGQSYLEAAEKDEIKKLLAASFLDH

BO12774.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG31715-PA 121 CG31715-PA 1..121 1..121 625 100 Plus
CG31715-PB 119 CG31715-PB 1..119 1..121 602 98.3 Plus
CG7423-PA 124 CG7423-PA 8..122 7..121 397 61.7 Plus
Tnks-PA 1181 CG4719-PA 686..788 18..120 148 33 Plus
Tnks-PB 1520 CG4719-PB 686..788 18..120 148 33 Plus