Clone BO13226 Report

Search the DGRC for BO13226

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:132
Well:26
Vector:pDNR-Dual
Associated Gene/Transcriptcib-RA
Protein status:BO13226.pep: validated full length
Sequenced Size:421

Clone Sequence Records

BO13226.3prime Sequence

419 bp (418 high quality bases) assembled on 2006-05-08

> BO13226.3prime
ATGGTCTAGAAAGCTTGCAGCCTGCTTCTCGGCCTCGATCACCTCCTTGG
TGGGCAGCACGTTCTTCTCATTGGTCTCGGTGTGCTTCAACTTTTTCGCA
TCAAAGTTCTCGATGCCGGCGATGAACTGATTCTTCTCCTTCTCCTGCTC
GATGGCTTCCTTATCGGGCAACGGGTTCTTCTCGTTGGTCTCCGTGTGCT
TCAAGTTGTTCTGATTGAAAGCGGTGATGCCCTCGAAGATCGACTGTTGG
GTCTTCTCGGCAGCCACATCTTCGGCGGTGGGAAGAATGATCTTCTCCTG
GGTGCTAGCGTTCTTCAGTTTGTCCTGGTTGAATCCCTCCAACTGGCTTT
TCAGGTTCTCGGCCACCTTGGGCAGATCCTTGAGTGCTGGTGCTGGGGCG
GCCATGTCGACTGATAACT

BO13226.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4944-PA 390 cib-RA 1..387 405..19 1935 100 Minus
CG4944-PB 390 cib-RB 1..387 405..19 1935 100 Minus
CG4944-PC 294 cib-RC 1..250 405..156 1250 100 Minus
CG4944-PC 294 cib-RC 249..294 146..101 230 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 16:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
cib-RE 911 CG4944-RE 177..563 405..19 1935 100 Minus
cib-RD 1502 CG4944-RD 423..809 405..19 1935 100 Minus
cib-RB 1173 CG4944-RB 94..480 405..19 1935 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 16:54:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4110150..4110288 157..19 695 100 Minus
X 23542271 X 4109689..4109824 405..270 680 100 Minus
X 23542271 X 4109895..4110010 271..156 580 100 Minus
Blast to na_te.dros performed on 2015-02-10 16:54:35 has no hits.

BO13226.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:58:23 Download gff for BO13226.3prime
Subject Subject Range Query Range Percent Splice Strand
cib-PB 1..390 15..405 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:42:19 Download gff for BO13226.3prime
Subject Subject Range Query Range Percent Splice Strand
CG4944-PB 1..390 15..405 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 23:18:45 Download gff for BO13226.3prime
Subject Subject Range Query Range Percent Splice Strand
cib-RB 94..483 15..405 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:51:20 Download gff for BO13226.3prime
Subject Subject Range Query Range Percent Splice Strand
cib-RB 94..483 15..405 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:51:20 Download gff for BO13226.3prime
Subject Subject Range Query Range Percent Splice Strand
X 4109685..4109824 270..410 98 -> Minus
X 4109897..4110010 156..269 100 -> Minus
X 4110152..4110286 21..155 100 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 23:18:45 Download gff for BO13226.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4003930..4004043 156..269 100 -> Minus
arm_X 4003718..4003857 270..410 98 -> Minus
arm_X 4004185..4004319 21..155 100 -> Minus

BO13226.5prime Sequence

419 bp (418 high quality bases) assembled on 2006-05-08

> BO13226.5prime
GAAGTTATCACTCGACATGGCCGCCCCAGCACCAGCACTCAAGGATCTGC
CCAAGGTGGCCGAGAACCTGAAAAGCCAGTTGGAGGGATTCAACCAGGAC
AAACTGAAGAACGCTAGCACCCAGGAGAAGATCATTCTTCCCACCGCCGA
AGATGTGGCTGCCGAGAAGACCCAACAGTCGATCTTCGAGGGCATCACCG
CTTTCAATCAGAACAACTTGAAGCACACGGAGACCAACGAGAAGAACCCG
TTGCCCGATAAGGAAGCCATCGAGCAGGAGAAGGAGAAGAATCAGTTCAT
CGCCGGCATCGAGAACTTTGATGCGAAAAAGTTGAAGCACACCGAGACCA
ATGAGAAGAACGTGCTGCCCACCAAGGAGGTGATCGAGGCCGAGAAGCAG
GCTGCAAGCTTTCTAGACC

BO13226.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:00:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG4944-PA 390 cib-RA 1..387 17..403 1935 100 Plus
CG4944-PB 390 cib-RB 1..387 17..403 1935 100 Plus
CG4944-PC 294 cib-RC 1..250 17..266 1250 100 Plus
CG4944-PC 294 cib-RC 249..294 276..321 230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 08:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
cib-RE 911 CG4944-RE 177..563 17..403 1935 100 Plus
cib-RD 1502 CG4944-RD 423..809 17..403 1935 100 Plus
cib-RB 1173 CG4944-RB 94..480 17..403 1935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 08:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4110150..4110288 265..403 695 100 Plus
X 23542271 X 4109689..4109824 17..152 680 100 Plus
X 23542271 X 4109895..4110010 151..266 580 100 Plus
Blast to na_te.dros performed on 2015-02-13 08:30:43 has no hits.

BO13226.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:58:24 Download gff for BO13226.5prime
Subject Subject Range Query Range Percent Splice Strand
cib-PB 1..390 17..407 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:42:21 Download gff for BO13226.5prime
Subject Subject Range Query Range Percent Splice Strand
CG4944-PB 1..390 17..407 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 09:37:11 Download gff for BO13226.5prime
Subject Subject Range Query Range Percent Splice Strand
cib-RB 86..483 10..407 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 10:18:07 Download gff for BO13226.5prime
Subject Subject Range Query Range Percent Splice Strand
cib-RB 86..483 10..407 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 10:18:07 Download gff for BO13226.5prime
Subject Subject Range Query Range Percent Splice Strand
X 4109897..4110010 153..266 100 -> Plus
X 4110152..4110286 267..401 100 -> Plus
X 4109685..4109824 12..152 98 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 09:37:11 Download gff for BO13226.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 4003718..4003857 12..152 98 -> Plus
arm_X 4003930..4004043 153..266 100 -> Plus
arm_X 4004185..4004319 267..401 100 -> Plus

BO13226.complete Sequence

421 bp assembled on 2006-10-11

GenBank Submission: FJ632726

> BO13226.complete
GAAGTTATCAGTCGACATGGCCGCCCCAGCACCAGCACTCAAGGATCTGC
CCAAGGTGGCCGAGAACCTGAAAAGCCAGTTGGAGGGATTCAACCAGGAC
AAACTGAAGAACGCTAGCACCCAGGAGAAGATCATTCTTCCCACCGCCGA
AGATGTGGCTGCCGAGAAGACCCAACAGTCGATCTTCGAGGGCATCACCG
CTTTCAATCAGAACAACTTGAAGCACACGGAGACCAACGAGAAGAACCCG
TTGCCCGATAAGGAAGCCATCGAGCAGGAGAAGGAGAAGAATCAGTTCAT
CGCCGGCATCGAGAACTTTGATGCGAAAAAGTTGAAGCACACCGAGACCA
ATGAGAAGAACGTGCTGCCCACCAAGGAGGTGATCGAGGCCGAGAAGCAG
GCTGCAAGCTTTCTAGACCAT

BO13226.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
cib-RE 390 CG4944-PE 1..387 17..403 1935 100 Plus
cib-RD 390 CG4944-PD 1..387 17..403 1935 100 Plus
cib-RB 390 CG4944-PB 1..387 17..403 1935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
cib-RE 911 CG4944-RE 177..563 17..403 1935 100 Plus
cib-RD 1502 CG4944-RD 423..809 17..403 1935 100 Plus
cib-RB 1173 CG4944-RB 94..480 17..403 1935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4110150..4110288 265..403 695 100 Plus
X 23542271 X 4109689..4109824 17..152 680 100 Plus
X 23542271 X 4109895..4110010 151..266 580 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:32:03 has no hits.

BO13226.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:48:24 Download gff for BO13226.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 1..390 17..407 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:03:14 Download gff for BO13226.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 94..483 17..407 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:45:46 Download gff for BO13226.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 94..480 17..405 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:48:24 Download gff for BO13226.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 94..483 17..407 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:13:47 Download gff for BO13226.complete
Subject Subject Range Query Range Percent Splice Strand
cib-RB 94..480 17..405 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:13:47 Download gff for BO13226.complete
Subject Subject Range Query Range Percent Splice Strand
X 4109897..4110010 153..266 100 -> Plus
X 4110152..4110288 267..405 98   Plus
X 4109689..4109824 17..152 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:45:46 Download gff for BO13226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4003722..4003857 17..152 100 -> Plus
arm_X 4003930..4004043 153..266 100 -> Plus
arm_X 4004185..4004321 267..405 98   Plus

BO13226.pep Sequence

Translation from 16 to 421

> BO13226.pep
MAAPAPALKDLPKVAENLKSQLEGFNQDKLKNASTQEKIILPTAEDVAAE
KTQQSIFEGITAFNQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIEN
FDAKKLKHTETNEKNVLPTKEVIEAEKQAASFLDH

BO13226.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:52:10
Subject Length Description Subject Range Query Range Score Percent Strand
cib-PE 129 CG4944-PE 1..129 1..129 650 100 Plus
cib-PD 129 CG4944-PD 1..129 1..129 650 100 Plus
cib-PB 129 CG4944-PB 1..129 1..129 650 100 Plus
cib-PA 129 CG4944-PA 1..129 1..129 650 100 Plus
cib-PC 97 CG4944-PC 1..88 1..88 422 95.5 Plus