Clone BO13264 Report

Search the DGRC for BO13264

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:132
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptSNCF-RA
Protein status:BO13264.pep: validated full length
Sequenced Size:472

Clone Sequence Records

BO13264.5prime Sequence

470 bp (469 high quality bases) assembled on 2006-05-08

> BO13264.5prime
GAAGTTATCAGTCGACATGATTGACCAGCACAAGCGCAGCCACAAATCAG
AGAAATCCAGTCGCAAGTCGGGAAAGAAACATTCCGACAAACCACACAAG
GTGAAGACCCACGATCCGCTCAAGAAACAAAAGAAGCGGGCTCTAAAGAA
GCTCCGCCGCAAGTCCGCCACCGTGAATTTCCCGTACCAACTCTTCTTGT
ACCGCCAAGAACTAAGGCGGGCCAGCGCCGACTTTTCCTATCTCCGGCTG
TCCAAGGCCAAGATAGTGCTTACCTCCCAACTAATCGCCAAGAAGATGGG
CAGCTGCAATCCCGATTGCAGCGTGGACGAGCTTAAGGAACTCAGCCGCG
AGGTGCAGTTCCAGAAACGCCTCTGCCATCAAGTGGAGCGCCTGCAGCAA
TTCCGGCAACTGGGACTCACCGAGATGATCCTCAACGGCAAGAAGACGAC
GCTGGCAAGCTTTCTAGACC

BO13264.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG14112-PA 441 SNCF-RA 1..438 17..454 2190 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:31:49
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-RA 608 CG14112-RA 39..477 16..454 2195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:31:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13378621..13379059 16..454 2195 100 Plus
Blast to na_te.dros performed 2015-02-12 06:31:46
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 2765..2820 43..98 109 66.1 Plus

BO13264.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 05:59:22 Download gff for BO13264.5prime
Subject Subject Range Query Range Percent Splice Strand
SNCF-PA 1..441 17..458 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:43:41 Download gff for BO13264.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14112-PA 1..441 17..458 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 03:03:41 Download gff for BO13264.5prime
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 34..483 9..461 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:11:08 Download gff for BO13264.5prime
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 34..483 9..461 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:11:08 Download gff for BO13264.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 13378616..13379065 9..461 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:03:41 Download gff for BO13264.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13371716..13372165 9..461 98   Plus

BO13264.complete Sequence

472 bp assembled on 2006-10-11

GenBank Submission: FJ632740

> BO13264.complete
GAAGTTATCAGTCGACATGATTGACCAGCACAAGCGCAGCCACAAATCAG
AGAAATCCAGTCGCAAGTCGGGAAAGAAACATTCCGACAAACCACACAAG
GTGAAGACCCACGATCCGCTCAAGAAACAAAAGAAGCGGGCTCTAAAGAA
GCTCCGCCGCAAGTCCGCCACCGTGAATTTCCCGTACCAACTCTTCTTGT
ACCGCCAAGAACTAAGGCGGGCCAGCGCCGACTTTTCCTATCTCCGGCTG
TCCAAGGCCAAGATAGTGCTTACCTCCCAACTAATCGCCAAGAAGATGGG
CAGCTGCAATCCCGATTGCAGCGTGGACGAGCTTAAGGAACTCAGCCGCG
AGGTGCAGTTCCAGAAACGCCTCTGCCATCAAGTGGAGCGCCTGCAGCAA
TTCCGGCAACTGGGACTCACCGAGATGATCCTCAACGGCAAGAAGACGAC
GCTGGCAAGCTTTCTAGACCAT

BO13264.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:09:44
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-RA 441 CG14112-PA 1..438 17..454 2190 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:09:45
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-RA 608 CG14112-RA 39..477 16..454 2195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13378621..13379059 16..454 2195 100 Plus
Blast to na_te.dros performed 2014-11-27 16:09:43
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 2765..2820 43..98 109 66.1 Plus

BO13264.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:48:02 Download gff for BO13264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 1..441 17..458 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:02:44 Download gff for BO13264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 32..481 9..461 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:50:11 Download gff for BO13264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 40..477 17..456 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:48:02 Download gff for BO13264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 32..481 9..461 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:12:13 Download gff for BO13264.complete
Subject Subject Range Query Range Percent Splice Strand
SNCF-RA 40..477 17..456 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:12:13 Download gff for BO13264.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13378622..13379059 17..456 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:50:11 Download gff for BO13264.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13371722..13372159 17..456 99   Plus

BO13264.pep Sequence

Translation from 16 to 472

> BO13264.pep
MIDQHKRSHKSEKSSRKSGKKHSDKPHKVKTHDPLKKQKKRALKKLRRKS
ATVNFPYQLFLYRQELRRASADFSYLRLSKAKIVLTSQLIAKKMGSCNPD
CSVDELKELSREVQFQKRLCHQVERLQQFRQLGLTEMILNGKKTTLASFL
DH

BO13264.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
SNCF-PA 146 CG14112-PA 1..146 1..146 744 100 Plus
CG13711-PA 127 CG13711-PA 31..115 47..134 150 37.5 Plus