Clone BO13405 Report

Search the DGRC for BO13405

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:134
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG30197-RA
Protein status:BO13405.pep: validated full length
Sequenced Size:373

Clone Sequence Records

BO13405.3prime Sequence

371 bp (370 high quality bases) assembled on 2006-05-08

> BO13405.3prime
ATGGTCTAGAAAGCTTGCCGATCTCACGCACTTGGGTCGCTTGGTGCTGC
GATCCATTTCGCATTTCTCAAAGCTGCCGCACTTGACATTGCCGCAATAA
CTGCCAGTAGCTCCAGAGTTCTTGCTGCCGAAGGGCGATTTATCGGCTCC
AGAATTTCCCAGGACATTCGGTTGAGCACAACTGCGACCGTTGCACAAAT
TCGGACAGCATTTTCCGCCGATGGCGCTGCACTCGCTGTCATGCAGGCAT
TTTGGCGTACAGTTCTGAACCTTGGTGGATGAAGGACAATCACCCGCAGC
AAAGGCAGCAACCACACAGGCAGCAATTAACAGTGAAAGAAAGCCGAGCT
TAACCATGTCGACTGATAACT

BO13405.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 342 CG30197-RA 1..339 357..19 1695 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 18:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 481 CG30197-RA 51..390 358..19 1700 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 18:56:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14514282..14514456 291..117 875 100 Minus
2R 25286936 2R 14514804..14514901 116..19 490 100 Minus
2R 25286936 2R 14514152..14514215 354..291 320 100 Minus
Blast to na_te.dros performed on 2015-02-11 18:56:27 has no hits.

BO13405.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:02:22 Download gff for BO13405.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-PA 1..342 16..357 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:47:49 Download gff for BO13405.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-PA 1..342 16..357 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 20:06:17 Download gff for BO13405.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..390 15..368 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 23:36:19 Download gff for BO13405.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 45..394 15..368 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 23:36:19 Download gff for BO13405.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14514150..14514215 291..358 97 -> Minus
2R 14514283..14514456 117..290 100 -> Minus
2R 14514804..14514905 15..116 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 20:06:17 Download gff for BO13405.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10401655..10401720 291..358 97 -> Minus
arm_2R 10401788..10401961 117..290 100 -> Minus
arm_2R 10402309..10402410 15..116 98   Minus

BO13405.5prime Sequence

371 bp (370 high quality bases) assembled on 2006-05-29

> BO13405.5prime
GAAGTTATCAGTCGACATGGTTAAGCTCGGCTTTCTTTCACTGTTAATTG
CTGCCTGTGTGGTTGCTGCCTTTGCTGCGGGTGATTGTCCTTCATCCACC
AAGGTTCAGAACTGTACGCCAAAATGCCTGCATGACAGCGAGTGCAGCGC
CATCGGCGGAAAATGCTGTCCGAATTTGTGCAACGGTCGCAGTTGTGCTC
AACCGAATGTCCTGGGAAATTCTGGAGCCGATAAATCGCCCTTCGGCAGC
AAGAACTCTGGAGCTACTGGCAGTTATTGCGGCAATGTCAAGTGCGGCAG
CTTTGAGAAATGCGAAATGGATCGCAGCACCAAGCGACCCAAGTGCGTGA
GATCGGCAAGCTTTCTAGACC

BO13405.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 342 CG30197-RA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 481 CG30197-RA 51..390 16..355 1700 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14514282..14514456 83..257 875 100 Plus
2R 25286936 2R 14514804..14514901 258..355 490 100 Plus
2R 25286936 2R 14514152..14514215 20..83 320 100 Plus
Blast to na_te.dros performed on 2015-02-12 13:45:55 has no hits.

BO13405.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:02:23 Download gff for BO13405.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-PA 1..342 17..358 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:47:50 Download gff for BO13405.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-PA 1..342 17..358 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 12:35:59 Download gff for BO13405.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..390 6..359 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:02:14 Download gff for BO13405.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 45..394 6..359 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:02:14 Download gff for BO13405.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14514804..14514905 258..359 98   Plus
2R 14514150..14514215 16..83 97 -> Plus
2R 14514283..14514456 84..257 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 12:35:59 Download gff for BO13405.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10401655..10401720 16..83 97 -> Plus
arm_2R 10401788..10401961 84..257 100 -> Plus
arm_2R 10402309..10402410 258..359 98   Plus

BO13405.complete Sequence

373 bp assembled on 2006-10-11

GenBank Submission: FJ632774

> BO13405.complete
GAAGTTATCAGTCGACATGGTTAAGCTCGGCTTTCTTTCACTGTTAATTG
CTGCCTGTGTGGTTGCTGCCTTTGCTGCGGGTGATTGTCCTTCATCCACC
AAGGTTCAGAACTGTACGCCAAAATGCCTGCATGACAGCGAGTGCAGCGC
CATCGGCGGAAAATGCTGTCCGAATTTGTGCAACGGTCGCAGTTGTGCTC
AACCGAATGTCCTGGGAAATTCTGGAGCCGATAAATCGCCCTTCGGCAGC
AAGAACTCTGGAGCTACTGGCAGTTATTGCGGCAATGTCAAGTGCGGCAG
CTTTGAGAAATGCGAAATGGATCGCAGCACCAAGCGACCCAAGTGCGTGA
GATCGGCAAGCTTTCTAGACCAT

BO13405.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 342 CG30197-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-RA 481 CG30197-RA 51..390 16..355 1700 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14514282..14514456 83..257 875 100 Plus
2R 25286936 2R 14514804..14514901 258..355 490 100 Plus
2R 25286936 2R 14514152..14514215 20..83 320 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:22:14 has no hits.

BO13405.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:47:27 Download gff for BO13405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 1..342 17..358 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:01:48 Download gff for BO13405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..390 6..359 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:47:47 Download gff for BO13405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 48..386 17..357 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:47:27 Download gff for BO13405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 41..390 6..359 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:52:15 Download gff for BO13405.complete
Subject Subject Range Query Range Percent Splice Strand
CG30197-RA 52..390 17..357 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:52:15 Download gff for BO13405.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14514151..14514215 17..83 97 -> Plus
2R 14514283..14514456 84..257 100 -> Plus
2R 14514804..14514901 258..357 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:47:47 Download gff for BO13405.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10401656..10401720 17..83 97 -> Plus
arm_2R 10401788..10401961 84..257 100 -> Plus
arm_2R 10402309..10402406 258..357 98   Plus

BO13405.pep Sequence

Translation from 16 to 373

> BO13405.pep
MVKLGFLSLLIAACVVAAFAAGDCPSSTKVQNCTPKCLHDSECSAIGGKC
CPNLCNGRSCAQPNVLGNSGADKSPFGSKNSGATGSYCGNVKCGSFEKCE
MDRSTKRPKCVRSASFLDH

BO13405.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG30197-PA 113 CG30197-PA 1..113 1..113 621 100 Plus