Clone BO13624 Report

Search the DGRC for BO13624

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:136
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptObp56e-RA
Protein status:BO13624.pep: validated full length
Sequenced Size:430

Clone Sequence Records

BO13624.5prime Sequence

428 bp (427 high quality bases) assembled on 2006-05-08

> BO13624.5prime
GAAGTTATCACTCGACATGAAAGTATTCTTTGTGTTTGCCGCCCTTGCAG
CTCTATCTTTGGCATCTGCCGTGGGGCTAACTGATTCCCAAAAGGCTGAG
GCAAAGCAGAGAGCCAAGGCCTGCGTCAAACAGGAGGGAATCACGAAGGA
GCAAGCTATTGCCCTGCGGTCTGGAAACTTTGCAGACTCCGATCCAAAGG
TAAAGTGCTTCGCCAACTGCTTCCTGGAGCAGACCGGCCTGGTGGCCAAT
GGGCAGATAAAACCTGACGTGGTTTTGGCCAAACTAGGTCCCATCGCCGG
CGAAGCCAATGTCAAGGAGGTGCAGGCCAAGTGTGACTCGACCAAGGGAG
CCGACAAGTGCGACACTAGCTATCTGCTGTACAAGTGCTACTACGAAAAC
CACGCCCAATTCGCAAGCTTTCTAGACC

BO13624.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG8462-PA 399 Obp56e-RA 1..396 17..412 1980 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:22:43
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RA 532 CG8462-RA 52..448 16..412 1985 100 Plus
Obp56e-RB 529 CG8462-RB 52..445 16..412 1930 99.2 Plus
Obp56d-RB 922 CG11218-RB 277..554 131..408 250 72.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:22:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19712509..19712848 73..412 1700 100 Plus
2R 25286936 2R 19712396..19712454 16..74 295 100 Plus
2R 25286936 2R 19703292..19703569 408..131 250 72.7 Minus
Blast to na_te.dros performed on 2015-02-10 22:22:40 has no hits.

BO13624.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:08:32 Download gff for BO13624.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8462-PA 1..399 17..416 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:56:18 Download gff for BO13624.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8462-PA 1..399 17..416 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 00:57:08 Download gff for BO13624.5prime
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 44..452 7..417 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:56:10 Download gff for BO13624.5prime
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 44..452 7..417 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:56:10 Download gff for BO13624.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 19712388..19712453 7..73 94 -> Plus
2R 19712510..19712852 74..417 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 00:57:08 Download gff for BO13624.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15599893..15599958 7..73 94 -> Plus
arm_2R 15600015..15600357 74..417 99   Plus

BO13624.complete Sequence

430 bp assembled on 2006-10-11

GenBank Submission: FJ632869

> BO13624.complete
GAAGTTATCAGTCGACATGAAAGTATTCTTTGTGTTTGCCGCCCTTGCAG
CTCTATCTTTGGCATCTGCCGTGGGGCTAACTGATTCCCAAAAGGCTGAG
GCAAAGCAGAGAGCCAAGGCCTGCGTCAAACAGGAGGGAATCACGAAGGA
GCAAGCTATTGCCCTGCGGTCTGGAAACTTTGCAGACTCCGATCCAAAGG
TAAAGTGCTTCGCCAACTGCTTCCTGGAGCAGACCGGCCTGGTGGCCAAT
GGGCAGATAAAACCTGACGTGGTTTTGGCCAAACTAGGTCCCATCGCCGG
CGAAGCCAATGTCAAGGAGGTGCAGGCCAAGTGTGACTCGACCAAGGGAG
CCGACAAGTGCGACACTAGCTATCTGCTGTACAAGTGCTACTACGAAAAC
CACGCCCAATTCGCAAGCTTTCTAGACCAT

BO13624.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RA 399 CG8462-PA 1..396 17..412 1980 100 Plus
Obp56e-RB 396 CG8462-PB 1..393 17..412 1900 99.2 Plus
Obp56d-RB 396 CG11218-PB 112..389 131..408 250 72.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-RA 532 CG8462-RA 52..448 16..412 1985 100 Plus
Obp56e-RB 529 CG8462-RB 52..445 16..412 1905 99.2 Plus
Obp56d-RB 922 CG11218-RB 277..554 131..408 250 72.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 11:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19712509..19712848 73..412 1700 100 Plus
2R 25286936 2R 19712396..19712454 16..74 295 100 Plus
2R 25286936 2R 19703292..19703569 408..131 250 72.7 Minus
Blast to na_te.dros performed on 2014-11-27 11:02:21 has no hits.

BO13624.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:58:48 Download gff for BO13624.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 1..399 17..416 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:51 Download gff for BO13624.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 44..452 7..417 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:44:12 Download gff for BO13624.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 53..448 17..414 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:58:49 Download gff for BO13624.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 44..452 7..417 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:37:17 Download gff for BO13624.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56e-RA 53..448 17..414 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:37:17 Download gff for BO13624.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19712397..19712453 17..73 100 -> Plus
2R 19712510..19712848 74..414 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:44:12 Download gff for BO13624.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15599902..15599958 17..73 100 -> Plus
arm_2R 15600015..15600353 74..414 99   Plus

BO13624.pep Sequence

Translation from 16 to 430

> BO13624.pep
MKVFFVFAALAALSLASAVGLTDSQKAEAKQRAKACVKQEGITKEQAIAL
RSGNFADSDPKVKCFANCFLEQTGLVANGQIKPDVVLAKLGPIAGEANVK
EVQAKCDSTKGADKCDTSYLLYKCYYENHAQFASFLDH

BO13624.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56e-PA 132 CG8462-PA 1..132 1..132 675 100 Plus
Obp56e-PB 131 CG8462-PB 1..131 1..132 659 99.2 Plus
Obp56d-PB 131 CG11218-PB 1..129 1..130 439 63.8 Plus
Obp56d-PA 131 CG11218-PA 1..129 1..130 439 63.8 Plus
Obp56a-PA 139 CG11797-PA 1..128 1..125 245 37.5 Plus