Clone BO13670 Report

Search the DGRC for BO13670

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:136
Well:70
Vector:pDNR-Dual
Associated Gene/TranscriptCG5791-RA
Protein status:BO13670.pep: validated full length
Sequenced Size:328

Clone Sequence Records

BO13670.3prime Sequence

326 bp (325 high quality bases) assembled on 2006-05-08

> BO13670.3prime
ATGGTCTAGAAAGCTTGCATAGGGATCCACGTTGCAGTGCTGACATCTGC
CATTGACGATGGTATTACCACCCCTCCGGTAAATGGTGCCACCTCCACCG
CCACTACCGTCATTTCCACGGGAAATGACCACATTACCATCGCCAGGGGA
TGAGGAGAAGCTGCGGTACTGCTGGCCATCCAGGTAGACGGGTTCACCAT
TCGGATTGGGACAAGTCAGACAGACGCCATTCACCACCACTGTGCTGGGA
TGAGCGCCGATCAGAGTCGGAATTAAAGCCAACGGGAGCAGCACACACGT
CAGGTACTTCATGTCGACTGATAACT

BO13670.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PA 297 CG5791-RA 1..294 312..19 1470 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 629 CG5791-RB 129..422 312..19 1470 100 Minus
CG5791-RC 1193 CG5791-RC 21..314 312..19 1470 100 Minus
CG5791-RA 350 CG5791-RA 22..315 312..19 1470 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 19:03:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22087429..22087622 212..19 970 100 Minus
3R 32079331 3R 22087203..22087260 312..255 290 100 Minus
3R 32079331 3R 22087317..22087361 255..211 225 100 Minus
Blast to na_te.dros performed on 2015-02-02 19:03:22 has no hits.

BO13670.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:09:49 Download gff for BO13670.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-PA 1..297 15..312 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:58:06 Download gff for BO13670.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-PA 1..297 15..312 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 17:20:53 Download gff for BO13670.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..373 11..312 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 21:05:53 Download gff for BO13670.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 22..324 11..312 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 21:05:53 Download gff for BO13670.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 22087203..22087260 255..312 100 -> Minus
3R 22087318..22087359 213..254 100 -> Minus
3R 22087429..22087631 11..212 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 17:20:53 Download gff for BO13670.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17912925..17912982 255..312 100 -> Minus
arm_3R 17913040..17913081 213..254 100 -> Minus
arm_3R 17913151..17913353 11..212 98   Minus

BO13670.5prime Sequence

326 bp (325 high quality bases) assembled on 2006-05-08

> BO13670.5prime
GAAGTTATCAGTCGACATGAAGTACCTGACGTGTGTGCTGCTCCCGTTGG
CTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGTGAAT
GGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACCTGGA
TGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAATGTGG
TCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCATTTAC
CGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCAACGT
GGATCCCTATGCAAGCTTTCTAGACC

BO13670.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:08:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PA 297 CG5791-RA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 629 CG5791-RB 129..422 17..310 1470 100 Plus
CG5791-RC 1193 CG5791-RC 21..314 17..310 1470 100 Plus
CG5791-RA 350 CG5791-RA 22..315 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22087429..22087622 117..310 970 100 Plus
3R 32079331 3R 22087203..22087260 17..74 290 100 Plus
3R 32079331 3R 22087317..22087361 74..118 225 100 Plus
Blast to na_te.dros performed on 2015-02-13 01:43:57 has no hits.

BO13670.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:09:50 Download gff for BO13670.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-PA 1..297 17..314 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:58:07 Download gff for BO13670.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-PA 1..297 17..314 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 15:28:20 Download gff for BO13670.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..373 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:06:18 Download gff for BO13670.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 22..324 17..318 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:06:18 Download gff for BO13670.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 22087203..22087260 17..74 100 -> Plus
3R 22087318..22087359 75..116 100 -> Plus
3R 22087429..22087631 117..318 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 15:28:20 Download gff for BO13670.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17912925..17912982 17..74 100 -> Plus
arm_3R 17913040..17913081 75..116 100 -> Plus
arm_3R 17913151..17913353 117..318 98   Plus

BO13670.complete Sequence

328 bp assembled on 2006-10-11

GenBank Submission: FJ632897

> BO13670.complete
GAAGTTATCAGTCGACATGAAGTACCTGACGTGTGTGCTGCTCCCGTTGG
CTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGTGAAT
GGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACCTGGA
TGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAATGTGG
TCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCATTTAC
CGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCAACGT
GGATCCCTATGCAAGCTTTCTAGACCAT

BO13670.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 297 CG5791-PB 1..294 17..310 1470 100 Plus
CG5791-RC 297 CG5791-PC 1..294 17..310 1470 100 Plus
CG5791-RA 297 CG5791-PA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-RB 629 CG5791-RB 129..422 17..310 1470 100 Plus
CG5791-RC 1193 CG5791-RC 21..314 17..310 1470 100 Plus
CG5791-RA 350 CG5791-RA 22..315 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22087429..22087622 117..310 970 100 Plus
3R 32079331 3R 22087203..22087260 17..74 290 100 Plus
3R 32079331 3R 22087317..22087361 74..118 225 100 Plus
Blast to na_te.dros performed on 2014-11-27 07:31:49 has no hits.

BO13670.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:58:47 Download gff for BO13670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 1..297 17..314 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:50 Download gff for BO13670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..373 17..318 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:15 Download gff for BO13670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..364 17..312 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:58:47 Download gff for BO13670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 71..373 17..318 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:29 Download gff for BO13670.complete
Subject Subject Range Query Range Percent Splice Strand
CG5791-RA 22..315 17..312 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:29 Download gff for BO13670.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22087318..22087359 75..116 100 -> Plus
3R 22087429..22087622 117..312 98   Plus
3R 22087203..22087260 17..74 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:15 Download gff for BO13670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17913040..17913081 75..116 100 -> Plus
arm_3R 17913151..17913344 117..312 98   Plus
arm_3R 17912925..17912982 17..74 100 -> Plus

BO13670.pep Sequence

Translation from 16 to 328

> BO13670.pep
MKYLTCVLLPLALIPTLIGAHPSTVVVNGVCLTCPNPNGEPVYLDGQQYR
SFSSSPGDGNVVISRGNDGSGGGGGTIYRRGGNTIVNGRCQHCNVDPYAS
FLDH

BO13670.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG5791-PB 98 CG5791-PB 1..98 1..98 539 100 Plus
CG5791-PC 98 CG5791-PC 1..98 1..98 539 100 Plus
CG5791-PA 98 CG5791-PA 1..98 1..98 539 100 Plus