Clone Sequence Records
BO13670.3prime Sequence
326 bp (325 high quality bases) assembled on 2006-05-08
> BO13670.3prime
ATGGTCTAGAAAGCTTGCATAGGGATCCACGTTGCAGTGCTGACATCTGC
CATTGACGATGGTATTACCACCCCTCCGGTAAATGGTGCCACCTCCACCG
CCACTACCGTCATTTCCACGGGAAATGACCACATTACCATCGCCAGGGGA
TGAGGAGAAGCTGCGGTACTGCTGGCCATCCAGGTAGACGGGTTCACCAT
TCGGATTGGGACAAGTCAGACAGACGCCATTCACCACCACTGTGCTGGGA
TGAGCGCCGATCAGAGTCGGAATTAAAGCCAACGGGAGCAGCACACACGT
CAGGTACTTCATGTCGACTGATAACT
BO13670.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:08:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5791-PA | 297 | CG5791-RA | 1..294 | 312..19 | 1470 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 19:03:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5791-RB | 629 | CG5791-RB | 129..422 | 312..19 | 1470 | 100 | Minus |
CG5791-RC | 1193 | CG5791-RC | 21..314 | 312..19 | 1470 | 100 | Minus |
CG5791-RA | 350 | CG5791-RA | 22..315 | 312..19 | 1470 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 19:03:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 22087429..22087622 | 212..19 | 970 | 100 | Minus |
3R | 32079331 | 3R | 22087203..22087260 | 312..255 | 290 | 100 | Minus |
3R | 32079331 | 3R | 22087317..22087361 | 255..211 | 225 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-02 19:03:22 has no hits.
BO13670.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:09:49 Download gff for
BO13670.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-PA | 1..297 | 15..312 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:58:06 Download gff for
BO13670.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-PA | 1..297 | 15..312 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 17:20:53 Download gff for
BO13670.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 71..373 | 11..312 | 99 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 21:05:53 Download gff for
BO13670.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 22..324 | 11..312 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 21:05:53 Download gff for
BO13670.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22087203..22087260 | 255..312 | 100 | -> | Minus |
3R | 22087318..22087359 | 213..254 | 100 | -> | Minus |
3R | 22087429..22087631 | 11..212 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 17:20:53 Download gff for
BO13670.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 17912925..17912982 | 255..312 | 100 | -> | Minus |
arm_3R | 17913040..17913081 | 213..254 | 100 | -> | Minus |
arm_3R | 17913151..17913353 | 11..212 | 98 | | Minus |
BO13670.5prime Sequence
326 bp (325 high quality bases) assembled on 2006-05-08
> BO13670.5prime
GAAGTTATCAGTCGACATGAAGTACCTGACGTGTGTGCTGCTCCCGTTGG
CTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGTGAAT
GGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACCTGGA
TGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAATGTGG
TCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCATTTAC
CGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCAACGT
GGATCCCTATGCAAGCTTTCTAGACC
BO13670.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:08:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5791-PA | 297 | CG5791-RA | 1..294 | 17..310 | 1470 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:44:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5791-RB | 629 | CG5791-RB | 129..422 | 17..310 | 1470 | 100 | Plus |
CG5791-RC | 1193 | CG5791-RC | 21..314 | 17..310 | 1470 | 100 | Plus |
CG5791-RA | 350 | CG5791-RA | 22..315 | 17..310 | 1470 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 01:43:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 22087429..22087622 | 117..310 | 970 | 100 | Plus |
3R | 32079331 | 3R | 22087203..22087260 | 17..74 | 290 | 100 | Plus |
3R | 32079331 | 3R | 22087317..22087361 | 74..118 | 225 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-13 01:43:57 has no hits.
BO13670.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:09:50 Download gff for
BO13670.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-PA | 1..297 | 17..314 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:58:07 Download gff for
BO13670.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-PA | 1..297 | 17..314 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-01 15:28:20 Download gff for
BO13670.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 71..373 | 17..318 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 03:06:18 Download gff for
BO13670.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 22..324 | 17..318 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 03:06:18 Download gff for
BO13670.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22087203..22087260 | 17..74 | 100 | -> | Plus |
3R | 22087318..22087359 | 75..116 | 100 | -> | Plus |
3R | 22087429..22087631 | 117..318 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-01 15:28:20 Download gff for
BO13670.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 17912925..17912982 | 17..74 | 100 | -> | Plus |
arm_3R | 17913040..17913081 | 75..116 | 100 | -> | Plus |
arm_3R | 17913151..17913353 | 117..318 | 98 | | Plus |
BO13670.complete Sequence
328 bp assembled on 2006-10-11
GenBank Submission: FJ632897
> BO13670.complete
GAAGTTATCAGTCGACATGAAGTACCTGACGTGTGTGCTGCTCCCGTTGG
CTTTAATTCCGACTCTGATCGGCGCTCATCCCAGCACAGTGGTGGTGAAT
GGCGTCTGTCTGACTTGTCCCAATCCGAATGGTGAACCCGTCTACCTGGA
TGGCCAGCAGTACCGCAGCTTCTCCTCATCCCCTGGCGATGGTAATGTGG
TCATTTCCCGTGGAAATGACGGTAGTGGCGGTGGAGGTGGCACCATTTAC
CGGAGGGGTGGTAATACCATCGTCAATGGCAGATGTCAGCACTGCAACGT
GGATCCCTATGCAAGCTTTCTAGACCAT
BO13670.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:31:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5791-RB | 297 | CG5791-PB | 1..294 | 17..310 | 1470 | 100 | Plus |
CG5791-RC | 297 | CG5791-PC | 1..294 | 17..310 | 1470 | 100 | Plus |
CG5791-RA | 297 | CG5791-PA | 1..294 | 17..310 | 1470 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:31:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5791-RB | 629 | CG5791-RB | 129..422 | 17..310 | 1470 | 100 | Plus |
CG5791-RC | 1193 | CG5791-RC | 21..314 | 17..310 | 1470 | 100 | Plus |
CG5791-RA | 350 | CG5791-RA | 22..315 | 17..310 | 1470 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:31:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 22087429..22087622 | 117..310 | 970 | 100 | Plus |
3R | 32079331 | 3R | 22087203..22087260 | 17..74 | 290 | 100 | Plus |
3R | 32079331 | 3R | 22087317..22087361 | 74..118 | 225 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 07:31:49 has no hits.
BO13670.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:58:47 Download gff for
BO13670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 1..297 | 17..314 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:50 Download gff for
BO13670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 71..373 | 17..318 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:17:15 Download gff for
BO13670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 71..364 | 17..312 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:58:47 Download gff for
BO13670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 71..373 | 17..318 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:12:29 Download gff for
BO13670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG5791-RA | 22..315 | 17..312 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:12:29 Download gff for
BO13670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 22087318..22087359 | 75..116 | 100 | -> | Plus |
3R | 22087429..22087622 | 117..312 | 98 | | Plus |
3R | 22087203..22087260 | 17..74 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:17:15 Download gff for
BO13670.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 17913040..17913081 | 75..116 | 100 | -> | Plus |
arm_3R | 17913151..17913344 | 117..312 | 98 | | Plus |
arm_3R | 17912925..17912982 | 17..74 | 100 | -> | Plus |
BO13670.pep Sequence
Translation from 16 to 328
> BO13670.pep
MKYLTCVLLPLALIPTLIGAHPSTVVVNGVCLTCPNPNGEPVYLDGQQYR
SFSSSPGDGNVVISRGNDGSGGGGGTIYRRGGNTIVNGRCQHCNVDPYAS
FLDH
BO13670.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:19:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG5791-PB | 98 | CG5791-PB | 1..98 | 1..98 | 539 | 100 | Plus |
CG5791-PC | 98 | CG5791-PC | 1..98 | 1..98 | 539 | 100 | Plus |
CG5791-PA | 98 | CG5791-PA | 1..98 | 1..98 | 539 | 100 | Plus |