Clone BO13681 Report

Search the DGRC for BO13681

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:136
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG8066-RA
Protein status:BO13681.pep: validated full length
Sequenced Size:346

Clone Sequence Records

BO13681.5prime Sequence

344 bp (343 high quality bases) assembled on 2006-05-08

> BO13681.5prime
GAAGTTATCAGTCGACATGTCCAACGTTCCAATTGTAGGCGGGATCAGTC
AGCTGGAGGGGAATGAGAGGAAGGAGGCTCTGGAACTCCTCGATGCCACC
CTCGCACAGTTGGCCAACGGAGATGGACCCAGCTACAAGGCACTTAATGT
AACCTCTGTGACGGGTCAGGTCGTAGCTGGAAGACTCAACACCTACGAGG
TGCAGCTGGACAATGGATCCGAGATAAAACAGGGCACTGTGCAGATCTGG
AGTCGCGCATGGCTAAAGGAGAACGGCACCAACATCAAGATCAAGTTCCC
GGGTGAGGACGAACTGGACCACACCTGGGCAAGCTTTCTAGACC

BO13681.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-PA 315 CG8066-RA 1..312 17..328 1560 100 Plus
CG8050-PA 381 Cys-RA 115..269 68..222 450 91.6 Plus
CG8050-PA 381 Cys-RA 305..343 258..296 170 97.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-RB 703 CG8066-RB 62..374 16..328 1565 100 Plus
CG8066-RA 1173 CG8066-RA 62..374 16..328 1565 100 Plus
Cys-RA 484 CG8050-RA 118..414 35..328 860 87 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14568410..14568599 328..139 950 100 Minus
3R 32079331 3R 14568663..14568786 139..16 620 100 Minus
3R 32079331 3R 14569173..14569365 328..139 525 86 Minus
3R 32079331 3R 14569423..14569527 139..35 315 86.7 Minus
Blast to na_te.dros performed on 2015-02-10 20:45:30 has no hits.

BO13681.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:10:06 Download gff for BO13681.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8066-PA 1..315 17..329 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 05:58:31 Download gff for BO13681.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8066-PA 1..315 17..329 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 02:42:13 Download gff for BO13681.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 53..384 6..337 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:18:15 Download gff for BO13681.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 53..384 6..337 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:18:15 Download gff for BO13681.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 14568400..14568599 139..337 98 <- Minus
3R 14568664..14568795 6..138 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 02:42:13 Download gff for BO13681.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10394122..10394321 139..337 98 <- Minus
arm_3R 10394386..10394517 6..138 97   Minus

BO13681.complete Sequence

346 bp assembled on 2006-10-11

GenBank Submission: FJ632903

> BO13681.complete
GAAGTTATCAGTCGACATGTCCAACGTTCCAATTGTAGGCGGGATCAGTC
AGCTGGAGGGGAATGAGAGGAAGGAGGCTCTGGAACTCCTCGATGCCACC
CTCGCACAGTTGGCCAACGGAGATGGACCCAGCTACAAGGCACTTAATGT
AACCTCTGTGACGGGTCAGGTCGTAGCTGGAAGACTCAACACCTACGAGG
TGCAGCTGGACAATGGATCCGAGATAAAACAGGGCACTGTGCAGATCTGG
AGTCGCGCATGGCTAAAGGAGAACGGCACCAACATCAAGATCAAGTTCCC
GGGTGAGGACGAACTGGACCACACCTGGGCAAGCTTTCTAGACCAT

BO13681.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:37:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-RB 315 CG8066-PB 1..312 17..328 1560 100 Plus
CG8066-RA 315 CG8066-PA 1..312 17..328 1560 100 Plus
Cys-RA 381 CG8050-PA 82..378 35..328 835 86.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-RB 703 CG8066-RB 62..374 16..328 1565 100 Plus
CG8066-RA 1173 CG8066-RA 62..374 16..328 1565 100 Plus
Cys-RA 484 CG8050-RA 118..414 35..328 835 86.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14568410..14568599 328..139 950 100 Minus
3R 32079331 3R 14568663..14568786 139..16 620 100 Minus
3R 32079331 3R 14569173..14569365 328..139 525 86 Minus
3R 32079331 3R 14569423..14569527 139..35 315 86.7 Minus
Blast to na_te.dros performed on 2014-11-27 07:37:43 has no hits.

BO13681.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:45:24 Download gff for BO13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 1..315 17..329 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:59:24 Download gff for BO13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 16..347 6..337 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:19:18 Download gff for BO13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 63..374 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:45:25 Download gff for BO13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 16..347 6..337 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:14:12 Download gff for BO13681.complete
Subject Subject Range Query Range Percent Splice Strand
CG8066-RA 63..374 17..330 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:14:12 Download gff for BO13681.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14568408..14568599 139..330 98 <- Minus
3R 14568664..14568785 17..138 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:19:18 Download gff for BO13681.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10394130..10394321 139..330 98 <- Minus
arm_3R 10394386..10394507 17..138 100   Minus

BO13681.pep Sequence

Translation from 16 to 346

> BO13681.pep
MSNVPIVGGISQLEGNERKEALELLDATLAQLANGDGPSYKALNVTSVTG
QVVAGRLNTYEVQLDNGSEIKQGTVQIWSRAWLKENGTNIKIKFPGEDEL
DHTWASFLDH

BO13681.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG8066-PB 104 CG8066-PB 1..104 1..104 538 100 Plus
CG8066-PA 104 CG8066-PA 1..104 1..104 538 100 Plus
Cys-PA 126 CG8050-PA 27..126 6..104 414 81 Plus
CG31313-PB 124 CG31313-PB 26..124 8..104 251 49.5 Plus
CG31313-PA 124 CG31313-PA 26..124 8..104 251 49.5 Plus