Clone BO13756 Report

Search the DGRC for BO13756

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:137
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG9691-RA
Protein status:BO13756.pep: Imported from assembly
Sequenced Size:397

Clone Sequence Records

BO13756.complete Sequence

397 bp assembled on 2008-11-10

GenBank Submission: KX797648

> BO13756.complete
GAAGTTATCAGTCGACATGAAATCGCTCGTTGTGTGCTCTTTGATCGGAT
TGGTCCTGCTTATGGCCGCTGGCCAAGTTCGTGCCGAGTGCGACGAGGCC
AAGAGTCCCGAGGACAGCGAATTCAAGCACTTCTTCAAGAACCTAGGCTG
CAAGGTCAACCAGGGGGCCAAGGAGGTGGCCGAGGCCGCCAAGCCCTACA
CCGACAAGATCGGCGAGGGCGCCAAGGAGTTTGGCAGCTCGGTGGCCCAG
AAGTACGACGAACTGAAGCACAAGCTGACCGATGAGCCATCGACCACGCC
CAAAATTCCAGTGGCCTATGACGCCCCCACCGAGAAGGTCCTTTTAGCCC
CCATCGGAGGACCCAGCACCCCGATCCCAGCAAGCTTTCTAGACCAT

BO13756.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-RA 366 CG9691-PA 1..363 17..379 1815 100 Plus
CG9691-RB 366 CG9691-PB 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-RA 534 CG9691-RA 61..423 17..379 1815 100 Plus
CG9691-RB 603 CG9691-RB 61..423 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9884502..9884864 17..379 1815 100 Plus
Blast to na_te.dros performed on 2014-11-27 06:53:15 has no hits.

BO13756.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:17:00 Download gff for BO13756.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 55..423 11..379 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:50 Download gff for BO13756.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 61..423 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:26:23 Download gff for BO13756.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 61..423 17..381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:57:15 Download gff for BO13756.complete
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 61..423 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:57:15 Download gff for BO13756.complete
Subject Subject Range Query Range Percent Splice Strand
X 9884502..9884864 17..381 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:50 Download gff for BO13756.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9778535..9778897 17..381 99   Plus

BO13756.5prime Sequence

395 bp (268 high quality bases) assembled on 2006-05-08

> BO13756.5prime
GAAGTTATCAGTCGACATGAAATCGCTCGTTGTGTGCTCTTTGATCGGAT
TGGTCCTGCTTATGGCCGCTGGCCAAGTTCGTGCCGAGTGCGACGAGGCC
AAGAGTCCCGAGGACAGCGAATTCTAGCACTTCTTCAAGAACCTAGGCTG
CAAGGTCAACCAGGGGGCCAAGGAGGTGGCCGAGGCCGCCAAGCCCTACA
CCGACAAGATCGGCGAGGGCGCCAAGGAGTTTGGCAGCTCGGTGGCCCAG
AAGTACGACGAACTGAAGCACAAGCTGACCGATGAGCCATCGACCACGCC
CAAAATTCCAGTGGCCTATGACGCCCCCACCGAGAAGGTCCTTTTAGCCC
CCATCGGAGGACCCAGCACCCCGATCCCAGCAAGCTTTCTAGACC

BO13756.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:10:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-PB 366 CG9691-RB 1..363 17..379 1790 99.7 Plus
CG9691-PA 366 CG9691-RA 1..363 17..379 1790 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 23:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-RA 534 CG9691-RA 61..423 17..379 1800 99.7 Plus
CG9691-RB 603 CG9691-RB 61..423 17..379 1800 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 23:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9884502..9884864 17..379 1800 99.7 Plus
Blast to na_te.dros performed on 2015-02-09 23:42:19 has no hits.

BO13756.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:11:38 Download gff for BO13756.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9691-PA 1..366 17..382 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:00:46 Download gff for BO13756.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9691-PA 1..366 17..382 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 08:29:53 Download gff for BO13756.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 55..423 11..379 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 00:57:33 Download gff for BO13756.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9691-RB 55..423 11..379 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 00:57:33 Download gff for BO13756.5prime
Subject Subject Range Query Range Percent Splice Strand
X 9884496..9884864 11..379 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 08:29:53 Download gff for BO13756.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 9778529..9778897 11..379 98   Plus

BO13756.pep Sequence

Translation from 16 to 397

> BO13756.pep
MKSLVVCSLIGLVLLMAAGQVRAECDEAKSPEDSEFKHFFKNLGCKVNQG
AKEVAEAAKPYTDKIGEGAKEFGSSVAQKYDELKHKLTDEPSTTPKIPVA
YDAPTEKVLLAPIGGPSTPIPASFLDH

BO13756.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG9691-PA 121 CG9691-PA 1..121 1..121 625 100 Plus
CG9691-PB 121 CG9691-PB 1..121 1..121 625 100 Plus