Clone BO13821 Report

Search the DGRC for BO13821

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:138
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG32160-RA
Protein status:BO13821.pep: validated full length
Sequenced Size:382

Clone Sequence Records

BO13821.5prime Sequence

380 bp (379 high quality bases) assembled on 2006-05-08

> BO13821.5prime
GAAGTTATCAGTCGACATGGCGATTGCGCAGGCGCGCAGGTCACTCATAC
GCCATGGACGCAGTGGTGGCGGCAAAAAGGGGATTAAGATATATATGATG
ATTTTCCTGACTAACCACTTTAGATCTTTGGCTACTTGGTTGTCACCTTA
CATCCCGTTTTTAATGATCCCCTCTAATATTTTTTGCATTTGCCACTGCT
TGCAAGTGACAAACACAACTGTACCTTCAATGGTGTTCAACTGTAGTTGT
ATTTACCGCCGTTATGGTGATTTGTCAGCAATTTTTAGCATGATTAATGA
ATGTTTCAATCCGGCGACACAACTCCCTCTTCCTCCAACCCACCGCTTTG
TTAGCCGAAATTCTGCAAGCTTTCTAGACC

BO13821.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG32160-PA 351 CG32160-RA 1..348 17..364 1715 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-13 08:17:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 08:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16310066..16310413 17..364 1725 99.7 Plus
Blast to na_te.dros performed 2015-02-13 08:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 2275..2348 190..118 115 63.5 Minus

BO13821.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:13:04 Download gff for BO13821.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32160-PA 1..351 17..367 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:02:53 Download gff for BO13821.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32160-PA 1..351 17..367 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 10:17:11 Download gff for BO13821.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310413 9..364 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 10:17:11 Download gff for BO13821.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310413 9..364 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 09:36:21 Download gff for BO13821.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303513 9..364 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 09:36:21 Download gff for BO13821.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303513 9..364 98   Plus

BO13821.3prime Sequence

380 bp (379 high quality bases) assembled on 2006-05-08

> BO13821.3prime
ATGGTCTAGAAAGCTTGCAGAATTTCGGCTAACAAAGCGGTGGGTTGGAG
GAAGAGGGAGTTGTGTCGCCGGATTGAAACATTCATTAATCATGCTAAAA
ATTGCTGACAAATCACCATAACGGCGGTAAATACAACTACAGTTGAACAC
CATTGAAGGTACAGTTGTGTTTGTCACTTGCAAGCAGTGGCAAATGCAAA
AAATATTAGAGGGGATCATTAAAAACGGGATGTAAGGTGACAACCAAGTA
GCCAAAGATCTAAAGTGGTTAGTCAGGAAAATCATCATATATATCTTAAT
CCCCTTTTTGCCGCCACCACTGCGTCCATGGCGTATGAGTGACCTGCGCG
CCTGCGCAATCGCCATGTCGACTGATAACT

BO13821.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG32160-PA 351 CG32160-RA 1..348 366..19 1715 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed on 2015-02-12 13:47:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16310066..16310413 366..19 1725 99.7 Minus
Blast to na_te.dros performed 2015-02-12 13:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 2275..2348 193..265 115 63.5 Plus

BO13821.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:13:03 Download gff for BO13821.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32160-PA 1..351 16..366 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:02:51 Download gff for BO13821.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32160-PA 1..351 16..366 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:06:57 Download gff for BO13821.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310413 19..374 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:06:57 Download gff for BO13821.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 16310061..16310413 19..374 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 12:36:29 Download gff for BO13821.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303513 19..374 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 12:36:29 Download gff for BO13821.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303161..16303513 19..374 98   Minus

BO13821.complete Sequence

382 bp assembled on 2006-10-11

GenBank Submission: FJ632937

> BO13821.complete
GAAGTTATCAGTCGACATGGCGATTGCGCAGGCGCGCAGGTCACTCATAC
GCCATGGACGCAGTGGTGGCGGCAAAAAGGGGATTAAGATATATATGATG
ATTTTCCTGACTAACCACTTTAGATCTTTGGCTACTTGGTTGTCACCTTA
CATCCCGTTTTTAATGATCCCCTCTAATATTTTTTGCATTTGCCACTGCT
TGCAAGTGACAAACACAACTGTACCTTCAATGGTGTTCAACTGTAGTTGT
ATTTACCGCCGTTATGGTGATTTGTCAGCAATTTTTAGCATGATTAATGA
ATGTTTCAATCCGGCGACACAACTCCCTCTTCCTCCAACCCACCGCTTTG
TTAGCCGAAATTCTGCAAGCTTTCTAGACCAT

BO13821.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 07:43:33 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 07:43:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16310066..16310413 17..364 1725 99.7 Plus
Blast to na_te.dros performed 2014-11-27 07:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 2275..2348 190..118 115 63.5 Minus

BO13821.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:58:46 Download gff for BO13821.complete
Subject Subject Range Query Range Percent Splice Strand
CG32160-RA 1..351 17..367 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:30:48 Download gff for BO13821.complete
Subject Subject Range Query Range Percent Splice Strand
CG32160-RA 881..1233 9..364 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:58:46 Download gff for BO13821.complete
Subject Subject Range Query Range Percent Splice Strand
CG32160-RA 881..1233 9..364 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:15:55 Download gff for BO13821.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16310066..16310413 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:15:55 Download gff for BO13821.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16310066..16310413 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:20 Download gff for BO13821.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303166..16303513 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:20 Download gff for BO13821.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16303166..16303513 17..366 99   Plus

BO13821.pep Sequence

Translation from 16 to 382

> BO13821.pep
MAIAQARRSLIRHGRSGGGKKGIKIYMMIFLTNHFRSLATWLSPYIPFLM
IPSNIFCICHCLQVTNTTVPSMVFNCSCIYRRYGDLSAIFSMINECFNPA
TQLPLPPTHRFVSRNSASFLDH
Sequence BO13821.pep has no blast hits.