Clone BO13824 Report

Search the DGRC for BO13824

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:138
Well:24
Vector:pDNR-Dual
Associated Gene/TranscriptCG11267-RA
Protein status:BO13824.pep: validated full length
Sequenced Size:343

Clone Sequence Records

BO13824.5prime Sequence

341 bp (340 high quality bases) assembled on 2006-05-08

> BO13824.5prime
GAAGTTATCAGTCGACATGGCCGCCGCTATCAAGAAGATCATCCCCATGC
TGGACCGCATCCTAATCCAGCGTGCCGAGGCGCTGACCAAGACGAAAGGA
GGCATTGTTTTGCCGGAGAAAGCGGTGGGCAAAGTACTTGAGGGCACCGT
TCTGGCCGTAGGCCCTGGCACCCGTAATGCCTCCACTGGCAACCACATTC
CCATTGGCGTGAAGGAGGGCGATCGTGTTCTGCTGCCCGAATTCGGTGGC
ACCAAGGTGAACCTAGAGGGTGACCAGAAGGAGCTGTTCCTCTTCCGCGA
GTCCGACATCCTGGCCAAATTGGAGGCAAGCTTTCTAGACC

BO13824.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-PA 312 CG11267-RA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-RA 594 CG11267-RA 113..421 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13016356..13016518 19..181 815 100 Plus
3L 28110227 3L 13016587..13016730 182..325 720 100 Plus
Blast to na_te.dros performed on 2015-02-12 06:59:37 has no hits.

BO13824.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:13:10 Download gff for BO13824.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-PA 1..312 17..326 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:03:02 Download gff for BO13824.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-PA 1..312 17..326 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 17:00:46 Download gff for BO13824.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 113..421 17..325 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:35:15 Download gff for BO13824.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 113..421 17..325 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:35:15 Download gff for BO13824.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 13016346..13016518 7..181 97 -> Plus
3L 13016587..13016730 182..325 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 17:00:46 Download gff for BO13824.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13009446..13009618 7..181 97 -> Plus
arm_3L 13009687..13009830 182..325 100   Plus

BO13824.3prime Sequence

341 bp (340 high quality bases) assembled on 2006-05-08

> BO13824.3prime
ATGGTCTAGAAAGCTTGCCTCCAATTTGGCCAGGATGTCGGACTCGCGGA
AGAGGAACAGCTCCTTCTGGTCACCCTCTAGGTTCACCTTGGTGCCACCG
AATTCGGGCAGCAGAACACGATCGCCCTCCTTCACGCCAATGGGAATGTG
GTTGCCAGTGGAGGCATTACGGGTGCCAGGGCCTACGGCCAGAACGGTGC
CCTCAAGTACTTTGCCCACCGCTTTCTCCGGCAAAACAATGCCTCCTTTC
GTCTTGGTCAGCGCCTCGGCACGCTGGATTAGGATGCGGTCCAGCATGGG
GATGATCTTCTTGATAGCGGCGGCCATGTCGACTGATAACT

BO13824.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-PA 312 CG11267-RA 1..309 327..19 1545 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-31 11:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-RA 594 CG11267-RA 113..421 327..19 1545 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-31 11:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13016356..13016518 325..163 815 100 Minus
3L 28110227 3L 13016587..13016730 162..19 720 100 Minus
Blast to na_te.dros performed on 2015-01-31 11:40:07 has no hits.

BO13824.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:13:09 Download gff for BO13824.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-PA 1..312 18..327 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:03:00 Download gff for BO13824.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-PA 1..312 18..327 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 23:51:18 Download gff for BO13824.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 113..421 19..327 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-31 12:57:31 Download gff for BO13824.3prime
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 113..421 19..327 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-31 12:57:31 Download gff for BO13824.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 13016346..13016518 163..337 97 -> Minus
3L 13016587..13016730 19..162 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 23:51:18 Download gff for BO13824.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13009446..13009618 163..337 97 -> Minus
arm_3L 13009687..13009830 19..162 100   Minus

BO13824.complete Sequence

343 bp assembled on 2006-10-11

GenBank Submission: FJ632939

> BO13824.complete
GAAGTTATCAGTCGACATGGCCGCCGCTATCAAGAAGATCATCCCCATGC
TGGACCGCATCCTAATCCAGCGTGCCGAGGCGCTGACCAAGACGAAAGGA
GGCATTGTTTTGCCGGAGAAAGCGGTGGGCAAAGTACTTGAGGGCACCGT
TCTGGCCGTAGGCCCTGGCACCCGTAATGCCTCCACTGGCAACCACATTC
CCATTGGCGTGAAGGAGGGCGATCGTGTTCTGCTGCCCGAATTCGGTGGC
ACCAAGGTGAACCTAGAGGGTGACCAGAAGGAGCTGTTCCTCTTCCGCGA
GTCCGACATCCTGGCCAAATTGGAGGCAAGCTTTCTAGACCAT

BO13824.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-RA 312 CG11267-PA 1..309 17..325 1545 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:15:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-RA 594 CG11267-RA 113..421 17..325 1545 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13016356..13016518 19..181 815 100 Plus
3L 28110227 3L 13016587..13016730 182..325 720 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:15:39 has no hits.

BO13824.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:44:44 Download gff for BO13824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 1..312 17..326 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:58:39 Download gff for BO13824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 106..414 17..325 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:22 Download gff for BO13824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 113..421 17..327 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:44:44 Download gff for BO13824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 106..414 17..325 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:22:00 Download gff for BO13824.complete
Subject Subject Range Query Range Percent Splice Strand
CG11267-RA 113..421 17..327 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:22:00 Download gff for BO13824.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13016355..13016518 17..181 99 -> Plus
3L 13016587..13016730 182..327 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:22 Download gff for BO13824.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13009455..13009618 17..181 99 -> Plus
arm_3L 13009687..13009830 182..327 98   Plus

BO13824.pep Sequence

Translation from 16 to 343

> BO13824.pep
MAAAIKKIIPMLDRILIQRAEALTKTKGGIVLPEKAVGKVLEGTVLAVGP
GTRNASTGNHIPIGVKEGDRVLLPEFGGTKVNLEGDQKELFLFRESDILA
KLEASFLDH

BO13824.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG11267-PA 103 CG11267-PA 1..103 1..103 509 100 Plus
CG9920-PA 102 CG9920-PA 1..102 1..103 333 64.1 Plus