Clone BO13847 Report

Search the DGRC for BO13847

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:138
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG3560-RA
Protein status:BO13847.pep: validated full length
Sequenced Size:367

Clone Sequence Records

BO13847.3prime Sequence

365 bp (364 high quality bases) assembled on 2006-05-08

> BO13847.3prime
ATGGTCTAGAAAGCTTGCGTGGATCTTTTCCCAGTCCTCACGCTCCTCGC
GCTCCTTCACGACCTCCTTGAGGTAGGGTTCCAGATACTTGACGTCCTCC
TCGTACTTGGTCCACTGCTCCTTGGGCAGAATGGTCTTGGTCATGGACAG
ATGGAGGGCCCTCATGATGCGGTAGTTACGCTCATCGTACAGCTTCCTGG
GCAATCGGCGCACGGCCTCCTTCACATCCTCGTTCTCATACAGACAATCA
TCGCGATGCAGACCGTATTGGTTGAATCCGGAGAGATTGTAGGCCCATCT
GCCCAGATTTGAGAGAACTGCGGGTCCCTTTCTGGCAATATAGTTCGACA
TGTCGACTGATAACT

BO13847.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-PA 336 CG3560-RA 1..333 351..19 1665 100 Minus
CG17856-PA 336 CG17856-RA 205..266 147..86 235 95.1 Minus
CG17856-PA 336 CG17856-RA 73..129 279..223 160 91.2 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-RA 523 CG3560-RA 122..455 352..19 1670 100 Minus
CG32576-RA 1709 CG32576-RA 742..987 19..264 1230 100 Plus
CG17856-RA 503 CG17856-RA 86..407 352..31 650 80.1 Minus
CG32576-RA 1709 CG32576-RA 1048..1097 262..311 250 100 Plus
CG32576-RA 1709 CG32576-RA 1213..1253 312..352 205 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16286675..16286920 264..19 1230 100 Minus
3R 32079331 3R 28294133..28294454 352..31 650 80.1 Minus
X 23542271 X 16286565..16286614 311..262 250 100 Minus
X 23542271 X 16286409..16286449 352..312 205 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:15:06 has no hits.

BO13847.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:13:40 Download gff for BO13847.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-PA 1..336 15..351 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:03:43 Download gff for BO13847.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-PA 1..336 15..351 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:20:11 Download gff for BO13847.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 122..458 15..352 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:36:41 Download gff for BO13847.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 122..458 15..352 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:36:41 Download gff for BO13847.3prime
Subject Subject Range Query Range Percent Splice Strand
X 16286403..16286449 312..357 93 -> Minus
X 16286565..16286612 264..311 100 -> Minus
X 16286676..16286923 15..263 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:20:11 Download gff for BO13847.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16180436..16180482 312..357 93 -> Minus
arm_X 16180598..16180645 264..311 100 -> Minus
arm_X 16180709..16180956 15..263 99   Minus

BO13847.5prime Sequence

365 bp (364 high quality bases) assembled on 2006-05-08

> BO13847.5prime
GAAGTTATCAGTCGACATGTCGAACTATATTGCCAGAAAGGGACCCGCAG
TTCTCTCAAATCTGGGCAGATGGGCCTACAATCTCTCCGGATTCAACCAA
TACGGTCTGCATCGCGATGATTGTCTGTATGAGAACGAGGATGTGAAGGA
GGCCGTGCGCCGATTGCCCAGGAAGCTGTACGATGAGCGTAACTACCGCA
TCATGAGGGCCCTCCATCTGTCCATGACCAAGACCATTCTGCCCAAGGAG
CAGTGGACCAAGTACGAGGAGGACGTCAAGTATCTGGAACCCTACCTCAA
GGAGGTCGTGAAGGAGCGCGAGGAGCGTGAGGACTGGGAAAAGATCCACG
CAAGCTTTCTAGACC

BO13847.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-PA 336 CG3560-RA 1..333 17..349 1665 100 Plus
CG17856-PA 336 CG17856-RA 205..266 221..282 235 95.1 Plus
CG17856-PA 336 CG17856-RA 73..129 89..145 160 91.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-RA 523 CG3560-RA 122..455 16..349 1670 100 Plus
CG32576-RA 1709 CG32576-RA 742..987 349..104 1230 100 Minus
CG17856-RA 503 CG17856-RA 86..407 16..337 650 80.1 Plus
CG32576-RA 1709 CG32576-RA 1048..1097 106..57 250 100 Minus
CG32576-RA 1709 CG32576-RA 1213..1253 56..16 205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:15:33
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16286675..16286920 104..349 1230 100 Plus
3R 32079331 3R 28294133..28294454 16..337 650 80.1 Plus
X 23542271 X 16286565..16286614 57..106 250 100 Plus
X 23542271 X 16286409..16286449 16..56 205 100 Plus
Blast to na_te.dros performed on 2015-02-12 06:15:36 has no hits.

BO13847.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:13:41 Download gff for BO13847.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-PA 1..336 17..353 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:03:44 Download gff for BO13847.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-PA 1..336 17..353 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 03:01:57 Download gff for BO13847.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 122..458 16..353 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 07:57:37 Download gff for BO13847.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 122..458 16..353 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 07:57:37 Download gff for BO13847.5prime
Subject Subject Range Query Range Percent Splice Strand
X 16286403..16286449 11..56 93 -> Plus
X 16286565..16286612 57..104 100 -> Plus
X 16286676..16286923 105..353 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 03:01:57 Download gff for BO13847.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 16180709..16180956 105..353 99   Plus
arm_X 16180436..16180482 11..56 93 -> Plus
arm_X 16180598..16180645 57..104 100 -> Plus

BO13847.complete Sequence

367 bp assembled on 2006-10-11

GenBank Submission: FJ632949

> BO13847.complete
GAAGTTATCAGTCGACATGTCGAACTATATTGCCAGAAAGGGACCCGCAG
TTCTCTCAAATCTGGGCAGATGGGCCTACAATCTCTCCGGATTCAACCAA
TACGGTCTGCATCGCGATGATTGTCTGTATGAGAACGAGGATGTGAAGGA
GGCCGTGCGCCGATTGCCCAGGAAGCTGTACGATGAGCGTAACTACCGCA
TCATGAGGGCCCTCCATCTGTCCATGACCAAGACCATTCTGCCCAAGGAG
CAGTGGACCAAGTACGAGGAGGACGTCAAGTATCTGGAACCCTACCTCAA
GGAGGTCGTGAAGGAGCGCGAGGAGCGTGAGGACTGGGAAAAGATCCACG
CAAGCTTTCTAGACCAT

BO13847.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-RA 336 CG3560-PA 1..333 17..349 1665 100 Plus
CG17856-RA 336 CG17856-PA 1..321 17..337 645 80.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:24:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-RA 523 CG3560-RA 122..455 16..349 1670 100 Plus
CG32576-RA 1709 CG32576-RA 742..987 349..104 1230 100 Minus
CG17856-RA 503 CG17856-RA 86..407 16..337 650 80.1 Plus
CG32576-RA 1709 CG32576-RA 1048..1097 106..57 250 100 Minus
CG32576-RA 1709 CG32576-RA 1213..1253 56..16 205 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:23:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 16286675..16286920 104..349 1230 100 Plus
3R 32079331 3R 28294133..28294454 16..337 650 80.1 Plus
X 23542271 X 16286565..16286614 57..106 250 100 Plus
X 23542271 X 16286409..16286449 16..56 205 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:24:01 has no hits.

BO13847.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:44:26 Download gff for BO13847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 1..336 17..353 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:58:22 Download gff for BO13847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 68..404 16..353 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:23:52 Download gff for BO13847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 123..455 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:44:26 Download gff for BO13847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 68..404 16..353 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:31:10 Download gff for BO13847.complete
Subject Subject Range Query Range Percent Splice Strand
CG3560-RA 123..455 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:31:10 Download gff for BO13847.complete
Subject Subject Range Query Range Percent Splice Strand
X 16286410..16286449 17..56 100 -> Plus
X 16286565..16286612 57..104 100 -> Plus
X 16286676..16286920 105..351 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:23:52 Download gff for BO13847.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16180443..16180482 17..56 100 -> Plus
arm_X 16180598..16180645 57..104 100 -> Plus
arm_X 16180709..16180953 105..351 99   Plus

BO13847.pep Sequence

Translation from 16 to 367

> BO13847.pep
MSNYIARKGPAVLSNLGRWAYNLSGFNQYGLHRDDCLYENEDVKEAVRRL
PRKLYDERNYRIMRALHLSMTKTILPKEQWTKYEEDVKYLEPYLKEVVKE
REEREDWEKIHASFLDH

BO13847.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG3560-PA 111 CG3560-PA 1..111 1..111 598 100 Plus
CG17856-PA 111 CG17856-PA 1..111 1..111 528 85.6 Plus