Clone BO13925 Report

Search the DGRC for BO13925

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:139
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptAst-C-RA
Protein status:BO13925.pep: validated full length
Sequenced Size:400

Clone Sequence Records

BO13925.3prime Sequence

398 bp (397 high quality bases) assembled on 2006-05-08

> BO13925.3prime
ATGGTCTAGAAAGCTTGCCTTCCTAAAGCAGGAGATGGGATTAAAGTAGC
ACTGCCGGTATCTAACTTGACGTTTGCTCTCGGGCAGCCGATAAAGTTCA
TTCACATTGCCGTAGGTGGGACTCCTCAAATAGGCGCTGTAACTGGTGGG
TCTGTATTGGGCAAAGAGCATCTGCAGCCGATCCATTGGAATATTGGGAT
AGATTGCCTGGGCTGGCATATCGTAGCCACCTCCATAGGCGCCTCGCACG
TCCTCCGCGTCCTGGCCATCAAGTCCATCGGAGTCCGGTCCTGTTTCGGC
ACCCGAAGGTCGGGCCTCGCTGAGGGCAAAGAACAGGGTGAGGAGTAGGC
CGTAGCACAATAATATCTGCACGAATTTCATCATGTCGACTGATAACT

BO13925.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14919-PA 369 Ast-C-RA 1..366 384..19 1830 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:04:34
Subject Length Description Subject Range Query Range Score Percent Strand
AstC-RA 1202 CG14919-RA 264..629 384..19 1830 100 Minus
AstC-RB 1199 CG14919-RB 264..626 384..19 1775 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 07:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11076927..11077067 146..286 705 100 Plus
2L 23513712 2L 11076738..11076864 19..145 635 100 Plus
2L 23513712 2L 11077122..11077221 285..384 500 100 Plus
Blast to na_te.dros performed on 2015-02-03 07:04:30 has no hits.

BO13925.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:15:21 Download gff for BO13925.3prime
Subject Subject Range Query Range Percent Splice Strand
Ast-C-PA 1..369 15..384 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:06:05 Download gff for BO13925.3prime
Subject Subject Range Query Range Percent Splice Strand
CG14919-PA 1..369 15..384 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:27:21 Download gff for BO13925.3prime
Subject Subject Range Query Range Percent Splice Strand
Ast-C-RA 264..635 11..384 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 09:42:49 Download gff for BO13925.3prime
Subject Subject Range Query Range Percent Splice Strand
AstC-RA 264..635 11..384 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 09:42:49 Download gff for BO13925.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 11076732..11076864 11..145 97 <- Plus
2L 11076927..11077066 146..285 100 <- Plus
2L 11077123..11077221 286..384 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:27:21 Download gff for BO13925.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11076732..11076864 11..145 97 <- Plus
arm_2L 11076927..11077066 146..285 100 <- Plus
arm_2L 11077123..11077221 286..384 100   Plus

BO13925.5prime Sequence

398 bp (397 high quality bases) assembled on 2006-05-08

> BO13925.5prime
GAAGTTATCAGTCGACATGATGAAATTCGTGCAGATATTATTGTGCTACG
GCCTACTCCTCACCCTGTTCTTTGCCCTCAGCGAGGCCCGACCTTCGGGT
GCCGAAACAGGACCGGACTCCGATGGACTTGATGGCCAGGACGCGGAGGA
CGTGCGAGGCGCCTATGGAGGTGGCTACGATATGCCAGCCCAGGCAATCT
ATCCCAATATTCCAATGGATCGGCTGCAGATGCTCTTTGCCCAATACAGA
CCCACCAGTTACAGCGCCTATTTGAGGAGTCCCACCTACGGCAATGTGAA
TGAACTTTATCGGCTGCCCGAGAGCAAACGTCAAGTTAGATACCGGCAGT
GCTACTTTAATCCCATCTCCTGCTTTAGGAAGGCAAGCTTTCTAGACC

BO13925.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14919-PA 369 Ast-C-RA 1..366 17..382 1830 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
AstC-RA 1202 CG14919-RA 264..629 17..382 1830 100 Plus
AstC-RB 1199 CG14919-RB 264..626 17..382 1775 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 19:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11076927..11077067 255..115 705 100 Minus
2L 23513712 2L 11076738..11076864 382..256 635 100 Minus
2L 23513712 2L 11077122..11077221 116..17 500 100 Minus
Blast to na_te.dros performed on 2015-02-12 19:07:53 has no hits.

BO13925.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:15:22 Download gff for BO13925.5prime
Subject Subject Range Query Range Percent Splice Strand
Ast-C-PA 1..369 17..386 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:06:07 Download gff for BO13925.5prime
Subject Subject Range Query Range Percent Splice Strand
CG14919-PA 1..369 17..386 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 10:15:12 Download gff for BO13925.5prime
Subject Subject Range Query Range Percent Splice Strand
Ast-C-RA 264..635 17..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 20:41:08 Download gff for BO13925.5prime
Subject Subject Range Query Range Percent Splice Strand
AstC-RA 264..635 17..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 20:41:08 Download gff for BO13925.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 11076927..11077066 116..255 100 <- Minus
2L 11077123..11077221 17..115 100   Minus
2L 11076732..11076864 256..390 97 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 10:15:12 Download gff for BO13925.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11076732..11076864 256..390 97 <- Minus
arm_2L 11076927..11077066 116..255 100 <- Minus
arm_2L 11077123..11077221 17..115 100   Minus

BO13925.complete Sequence

400 bp assembled on 2006-10-11

GenBank Submission: FJ632976

> BO13925.complete
GAAGTTATCAGTCGACATGATGAAATTCGTGCAGATATTATTGTGCTACG
GCCTACTCCTCACCCTGTTCTTTGCCCTCAGCGAGGCCCGACCTTCGGGT
GCCGAAACAGGACCGGACTCCGATGGACTTGATGGCCAGGACGCGGAGGA
CGTGCGAGGCGCCTATGGAGGTGGCTACGATATGCCAGCCCAGGCAATCT
ATCCCAATATTCCAATGGATCGGCTGCAGATGCTCTTTGCCCAATACAGA
CCCACCAGTTACAGCGCCTATTTGAGGAGTCCCACCTACGGCAATGTGAA
TGAACTTTATCGGCTGCCCGAGAGCAAACGTCAAGTTAGATACCGGCAGT
GCTACTTTAATCCCATCTCCTGCTTTAGGAAGGCAAGCTTTCTAGACCAT

BO13925.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:41:52
Subject Length Description Subject Range Query Range Score Percent Strand
AstC-RA 369 CG14919-PA 1..366 17..382 1830 100 Plus
AstC-RB 366 CG14919-PB 1..363 17..382 1750 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
AstC-RA 1202 CG14919-RA 264..629 17..382 1830 100 Plus
AstC-RB 1199 CG14919-RB 264..626 17..382 1750 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:41:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11076927..11077067 255..115 705 100 Minus
2L 23513712 2L 11076738..11076864 382..256 635 100 Minus
2L 23513712 2L 11077122..11077221 116..17 500 100 Minus
Blast to na_te.dros performed on 2014-11-27 14:41:50 has no hits.

BO13925.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:20 Download gff for BO13925.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-C-RA 1..369 17..386 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:03:02 Download gff for BO13925.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-C-RA 262..633 17..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:40 Download gff for BO13925.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-C-RA 264..629 17..384 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:20 Download gff for BO13925.complete
Subject Subject Range Query Range Percent Splice Strand
Ast-C-RA 262..633 17..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:16:56 Download gff for BO13925.complete
Subject Subject Range Query Range Percent Splice Strand
AstC-RA 264..629 17..384 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:16:56 Download gff for BO13925.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11076736..11076864 256..384 98 <- Minus
2L 11076927..11077066 116..255 100 <- Minus
2L 11077123..11077221 17..115 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:40 Download gff for BO13925.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11076736..11076864 256..384 98 <- Minus
arm_2L 11076927..11077066 116..255 100 <- Minus
arm_2L 11077123..11077221 17..115 100   Minus

BO13925.pep Sequence

Translation from 16 to 400

> BO13925.pep
MMKFVQILLCYGLLLTLFFALSEARPSGAETGPDSDGLDGQDAEDVRGAY
GGGYDMPAQAIYPNIPMDRLQMLFAQYRPTSYSAYLRSPTYGNVNELYRL
PESKRQVRYRQCYFNPISCFRKASFLDH

BO13925.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
AstC-PA 122 CG14919-PA 1..122 1..122 651 100 Plus
AstC-PB 121 CG14919-PB 1..121 1..122 635 99.2 Plus