Clone BO13950 Report

Search the DGRC for BO13950

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:139
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG11752-RA
Protein status:BO13950.pep: validated full length
Sequenced Size:361

Clone Sequence Records

BO13950.5prime Sequence

359 bp (358 high quality bases) assembled on 2006-05-08

> BO13950.5prime
GAAGTTATCAGTCGACATGTTCTCGCCCTCACGTGCCCTGCGCCCAGCCC
TCAGCCGCTGCTACAGCCAGATCAAGGGCGGACCCGTTTCCGGCGGCGGT
AGACCCAGCGCCTCAGGATCTCCAGCTGGAGCCGGATCCTCGCCATCGGG
CGGCGCATCCTCGCCATCGGTTGTGGGACTGACCAGCAATTGCGTGAAGC
CCAGCAGCGGACCCGTTGGACCAGGTGCCTCCGCCACCGGTGGCTACAAG
GTGCCTGAATACTACAGCTTCAATCGCTTTAGCTACGCCGAGGCGGAGGT
GGAAATGGCCAAGTACCGCTGCCCACAGCCCTCGGCCCTCAAGGCAAGCT
TTCTAGACC

BO13950.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:13:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-PA 330 CG11752-RA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:29:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-RA 477 CG11752-RA 97..425 15..343 1645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11350094..11350422 15..343 1645 100 Plus
Blast to na_te.dros performed on 2015-02-10 20:29:20 has no hits.

BO13950.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:15:53 Download gff for BO13950.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11752-PA 1..330 17..344 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:06:53 Download gff for BO13950.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11752-PA 1..330 17..344 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 02:40:32 Download gff for BO13950.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 88..425 5..343 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:39:48 Download gff for BO13950.5prime
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 88..425 5..343 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 22:39:48 Download gff for BO13950.5prime
Subject Subject Range Query Range Percent Splice Strand
X 11350085..11350422 5..343 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 02:40:32 Download gff for BO13950.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 11244118..11244455 5..343 98   Plus

BO13950.complete Sequence

361 bp assembled on 2006-10-11

GenBank Submission: FJ632981

> BO13950.complete
GAAGTTATCAGTCGACATGTTCTCGCCCTCACGTGCCCTGCGCCCAGCCC
TCAGCCGCTGCTACAGCCAGATCAAGGGCGGACCCGTTTCCGGCGGCGGT
AGACCCAGCGCCTCAGGATCTCCAGCTGGAGCCGGATCCTCGCCATCGGG
CGGCGCATCCTCGCCATCGGTTGTGGGACTGACCAGCAATTGCGTGAAGC
CCAGCAGCGGACCCGTTGGACCAGGTGCCTCCGCCACCGGTGGCTACAAG
GTGCCTGAATACTACAGCTTCAATCGCTTTAGCTACGCCGAGGCGGAGGT
GGAAATGGCCAAGTACCGCTGCCCACAGCCCTCGGCCCTCAAGGCAAGCT
TTCTAGACCAT

BO13950.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:44:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-RA 330 CG11752-PA 1..327 17..343 1635 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:44:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-RA 477 CG11752-RA 97..425 15..343 1645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11350094..11350422 15..343 1645 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:44:30 has no hits.

BO13950.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:23:24 Download gff for BO13950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 1..330 17..344 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:57:14 Download gff for BO13950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 87..424 5..343 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:44:46 Download gff for BO13950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 104..425 22..345 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:23:24 Download gff for BO13950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 87..424 5..343 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:51:47 Download gff for BO13950.complete
Subject Subject Range Query Range Percent Splice Strand
CG11752-RA 104..425 22..345 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:51:47 Download gff for BO13950.complete
Subject Subject Range Query Range Percent Splice Strand
X 11350101..11350422 22..345 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:44:46 Download gff for BO13950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11244134..11244455 22..345 99   Plus

BO13950.pep Sequence

Translation from 16 to 361

> BO13950.pep
MFSPSRALRPALSRCYSQIKGGPVSGGGRPSASGSPAGAGSSPSGGASSP
SVVGLTSNCVKPSSGPVGPGASATGGYKVPEYYSFNRFSYAEAEVEMAKY
RCPQPSALKASFLDH

BO13950.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG11752-PA 109 CG11752-PA 1..109 1..109 571 100 Plus