BO14044.complete Sequence
412 bp assembled on 2008-08-15
GenBank Submission: FJ633007
> BO14044.complete
GAAGTTATCAGTCGACATGAAGATGATACTTGCGCTTGTCGTCCTTGGAC
TGGTGCTGGTCGCCGCCGAGGATAAGTACACCACCAAGTACGACAACATC
GACGTCGACGAGATCCTGAAGTCGGACCGCCTCTTCGGAAACTACTTCAA
GTGCCTGGTGGACAACGGAAAGTGCACCCCGGAGGGCCGGGAGCTCAAGA
AGTCCCTGCCGGACGCCCTGAAGACGGAGTGCAGCAAGTGCAGCGAGAAG
CAGCGCCAGAACACCGACAAGGTCATTCGCTACATCATCGAAAACAAGCC
CGAGGAGTGGAAGCAGCTGCAGGCCAAGTACGATCCCGATGAGATCTACA
TCAAGCGCTACCGCGCCACCGCCGAGGCCTCGGGAATCAAGGTGGCAAGC
TTTCTAGACCAT
BO14044.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:37:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
PebIII-RC | 381 | CG11390-PC | 1..378 | 17..394 | 1890 | 100 | Plus |
PebIII-RB | 381 | CG11390-PB | 1..378 | 17..394 | 1890 | 100 | Plus |
PebIII-RA | 381 | CG11390-PA | 1..378 | 17..394 | 1890 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:37:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
PebIII-RC | 836 | CG11390-RC | 333..710 | 17..394 | 1890 | 100 | Plus |
PebIII-RB | 768 | CG11390-RB | 265..642 | 17..394 | 1890 | 100 | Plus |
PebIII-RA | 586 | CG11390-RA | 83..460 | 17..394 | 1890 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:37:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24027015..24027392 | 17..394 | 1890 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 14:37:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
G-element | 4346 | G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). | 1589..1626 | 65..102 | 118 | 78.9 | Plus |
BO14044.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:22 Download gff for
BO14044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebIII-RA | 96..477 | 17..399 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:12 Download gff for
BO14044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebIII-RA | 83..460 | 17..396 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:00:53 Download gff for
BO14044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebIII-RA | 96..473 | 17..396 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:15 Download gff for
BO14044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
PebIII-RA | 83..460 | 17..396 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:49:15 Download gff for
BO14044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24027015..24027392 | 17..396 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:12 Download gff for
BO14044.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19914538..19914915 | 17..396 | 99 | | Plus |
BO14044.pep Sequence
Translation from 16 to 412
> BO14044.pep
MKMILALVVLGLVLVAAEDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDN
GKCTPEGRELKKSLPDALKTECSKCSEKQRQNTDKVIRYIIENKPEEWKQ
LQAKYDPDEIYIKRYRATAEASGIKVASFLDH
BO14044.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:31:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
PebIII-PC | 126 | CG11390-PC | 1..126 | 1..126 | 654 | 100 | Plus |
PebIII-PB | 126 | CG11390-PB | 1..126 | 1..126 | 654 | 100 | Plus |
PebIII-PA | 126 | CG11390-PA | 1..126 | 1..126 | 654 | 100 | Plus |
Phk-3-PC | 121 | CG9358-PC | 1..114 | 1..111 | 334 | 57 | Plus |
Phk-3-PB | 121 | CG9358-PB | 1..114 | 1..111 | 334 | 57 | Plus |