Clone BO14044 Report

Search the DGRC for BO14044

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:140
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptPebIII-RA
Protein status:BO14044.pep: Imported from assembly
Sequenced Size:412

Clone Sequence Records

BO14044.complete Sequence

412 bp assembled on 2008-08-15

GenBank Submission: FJ633007

> BO14044.complete
GAAGTTATCAGTCGACATGAAGATGATACTTGCGCTTGTCGTCCTTGGAC
TGGTGCTGGTCGCCGCCGAGGATAAGTACACCACCAAGTACGACAACATC
GACGTCGACGAGATCCTGAAGTCGGACCGCCTCTTCGGAAACTACTTCAA
GTGCCTGGTGGACAACGGAAAGTGCACCCCGGAGGGCCGGGAGCTCAAGA
AGTCCCTGCCGGACGCCCTGAAGACGGAGTGCAGCAAGTGCAGCGAGAAG
CAGCGCCAGAACACCGACAAGGTCATTCGCTACATCATCGAAAACAAGCC
CGAGGAGTGGAAGCAGCTGCAGGCCAAGTACGATCCCGATGAGATCTACA
TCAAGCGCTACCGCGCCACCGCCGAGGCCTCGGGAATCAAGGTGGCAAGC
TTTCTAGACCAT

BO14044.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
PebIII-RC 381 CG11390-PC 1..378 17..394 1890 100 Plus
PebIII-RB 381 CG11390-PB 1..378 17..394 1890 100 Plus
PebIII-RA 381 CG11390-PA 1..378 17..394 1890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
PebIII-RC 836 CG11390-RC 333..710 17..394 1890 100 Plus
PebIII-RB 768 CG11390-RB 265..642 17..394 1890 100 Plus
PebIII-RA 586 CG11390-RA 83..460 17..394 1890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24027015..24027392 17..394 1890 100 Plus
Blast to na_te.dros performed 2014-11-27 14:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
G-element 4346 G-element DMREPG 4346bp Derived from X06950 (g8427) (Rel. 16, Last updated, Version 1). 1589..1626 65..102 118 78.9 Plus

BO14044.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:14:22 Download gff for BO14044.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 96..477 17..399 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:43:12 Download gff for BO14044.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 83..460 17..396 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 18:00:53 Download gff for BO14044.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 96..473 17..396 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:49:15 Download gff for BO14044.complete
Subject Subject Range Query Range Percent Splice Strand
PebIII-RA 83..460 17..396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:49:15 Download gff for BO14044.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24027015..24027392 17..396 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:43:12 Download gff for BO14044.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19914538..19914915 17..396 99   Plus

BO14044.pep Sequence

Translation from 16 to 412

> BO14044.pep
MKMILALVVLGLVLVAAEDKYTTKYDNIDVDEILKSDRLFGNYFKCLVDN
GKCTPEGRELKKSLPDALKTECSKCSEKQRQNTDKVIRYIIENKPEEWKQ
LQAKYDPDEIYIKRYRATAEASGIKVASFLDH

BO14044.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
PebIII-PC 126 CG11390-PC 1..126 1..126 654 100 Plus
PebIII-PB 126 CG11390-PB 1..126 1..126 654 100 Plus
PebIII-PA 126 CG11390-PA 1..126 1..126 654 100 Plus
Phk-3-PC 121 CG9358-PC 1..114 1..111 334 57 Plus
Phk-3-PB 121 CG9358-PB 1..114 1..111 334 57 Plus