Clone BO14089 Report

Search the DGRC for BO14089

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:140
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCpr65Av-RA
Protein status:BO14089.pep: validated full length
Sequenced Size:367

Clone Sequence Records

BO14089.5prime Sequence

365 bp (364 high quality bases) assembled on 2006-05-29

> BO14089.5prime
GAAGTTATCAGTCGACATGCAGTCCTCCAGCATCTGTGTCCTGGCCATTT
GCGCCTTCGCTCTGCTCTCCACCATTAGGGCTGCTCCTCTGGACGACTCC
CAACATGCCACCATACTAAGATACGACAACGACAACATTGGCACTGATGG
CTACAACTTCGGCTACGAGACCAGTGATGGAGTTACCCGCCAGGAGCAGG
CTGAGGTGAAGAACGCCGGTACCGACCAGGAGGCGCTCAGTGTGCGCGGT
TCCGTCAGCTGGGTTGCTCCCGATGGCCAGACCTACACCCTGCACTACAT
TGCGGATGAGAACGGTTTCCAGCCCCAGGGCGATCATCTGCCCCACAACG
CAAGCTTTCTAGACC

BO14089.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:15:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG32405-PA 336 CG32405-RA 1..333 17..349 1665 100 Plus
CG8505-PA 405 CG8505-RA 289..327 305..343 170 97.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 07:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Av-RA 642 CG32405-RA 112..446 15..349 1675 100 Plus
Cpr65Ax1-RA 389 CG34270-RA 190..339 194..343 225 77.5 Plus
Cpr65Ax2-RB 732 CG18777-RB 189..338 194..343 225 77.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 07:35:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6139419..6139610 349..158 945 99.5 Minus
3L 28110227 3L 6139716..6139863 162..15 740 100 Minus
3L 28110227 3L 6147581..6147730 343..194 225 76.7 Minus
3L 28110227 3L 6150452..6150601 343..194 225 76.7 Minus
3L 28110227 3L 6145138..6145289 192..343 205 75.7 Plus
3L 28110227 3L 6152287..6152379 343..251 195 80.6 Minus
3L 28110227 3L 6133172..6133243 343..272 180 83.3 Minus
3L 28110227 3L 6134853..6134924 343..272 180 83.3 Minus
2R 25286936 2R 12404317..12404355 305..343 180 97.4 Plus
Blast to na_te.dros performed on 2015-02-13 07:35:14 has no hits.

BO14089.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:18:50 Download gff for BO14089.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32405-PA 1..336 17..353 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:11:06 Download gff for BO14089.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32405-PA 1..336 17..353 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 09:32:21 Download gff for BO14089.5prime
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 112..456 15..359 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:45:46 Download gff for BO14089.5prime
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 112..456 15..359 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 09:45:46 Download gff for BO14089.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 6139409..6139605 163..359 97 <- Minus
3L 6139716..6139863 15..162 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 09:32:21 Download gff for BO14089.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6132509..6132705 163..359 97 <- Minus
arm_3L 6132816..6132963 15..162 100   Minus

BO14089.complete Sequence

367 bp assembled on 2006-10-11

GenBank Submission: FJ633023

> BO14089.complete
GAAGTTATCAGTCGACATGCAGTCCTCCAGCATCTGTGTCCTGGCCATTT
GCGCCTTCGCTCTGCTCTCCACCATTAGGGCTGCTCCTCTGGACGACTCC
CAACATGCCACCATACTAAGATACGACAACGACAACATTGGCACTGATGG
CTACAACTTCGGCTACGAGACCAGTGATGGAGTTACCCGCCAGGAGCAGG
CTGAGGTGAAGAACGCCGGTACCGACCAGGAGGCGCTCAGTGTGCGCGGT
TCCGTCAGCTGGGTTGCTCCCGATGGCCAGACCTACACCCTGCACTACAT
TGCGGATGAGAACGGTTTCCAGCCCCAGGGCGATCATCTGCCCCACAACG
CAAGCTTTCTAGACCAT

BO14089.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Av-RA 336 CG32405-PA 1..333 17..349 1665 100 Plus
Cpr65Ax1-RA 309 CG34270-PA 142..291 194..343 225 76.7 Plus
Cpr65Ax2-RB 309 CG18777-PB 142..291 194..343 225 76.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:25:08
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Av-RA 642 CG32405-RA 112..446 15..349 1675 100 Plus
Cpr65Ax1-RA 389 CG34270-RA 190..339 194..343 225 76.7 Plus
Cpr65Ax2-RB 732 CG18777-RB 189..338 194..343 225 76.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6139419..6139610 349..158 945 99.5 Minus
3L 28110227 3L 6139716..6139863 162..15 740 100 Minus
3L 28110227 3L 6147581..6147730 343..194 225 76.7 Minus
3L 28110227 3L 6150452..6150601 343..194 225 76.7 Minus
3L 28110227 3L 6145138..6145289 192..343 205 75.7 Plus
3L 28110227 3L 6152287..6152379 343..251 195 80.6 Minus
3L 28110227 3L 6133172..6133243 343..272 180 83.3 Minus
3L 28110227 3L 6134853..6134924 343..272 180 83.3 Minus
2R 25286936 2R 12404317..12404355 305..343 180 97.4 Plus
Blast to na_te.dros performed on 2014-11-27 15:25:06 has no hits.

BO14089.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:47 Download gff for BO14089.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 1..336 17..353 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:56:42 Download gff for BO14089.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 111..455 15..359 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:40:51 Download gff for BO14089.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 114..446 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:47 Download gff for BO14089.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 111..455 15..359 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:13 Download gff for BO14089.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr65Av-RA 114..446 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:13 Download gff for BO14089.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6139716..6139861 17..162 100   Minus
3L 6139417..6139605 163..351 98 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:40:51 Download gff for BO14089.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6132517..6132705 163..351 98 <- Minus
arm_3L 6132816..6132961 17..162 100   Minus

BO14089.pep Sequence

Translation from 16 to 367

> BO14089.pep
MQSSSICVLAICAFALLSTIRAAPLDDSQHATILRYDNDNIGTDGYNFGY
ETSDGVTRQEQAEVKNAGTDQEALSVRGSVSWVAPDGQTYTLHYIADENG
FQPQGDHLPHNASFLDH

BO14089.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:42:00
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr65Av-PA 111 CG32405-PA 1..111 1..111 587 100 Plus
Acp65Aa-PA 105 CG10297-PA 5..104 8..109 293 52.4 Plus
Lcp65Ac-PA 109 CG6956-PA 3..104 7..110 289 55.8 Plus
Cpr65Aw-PA 117 CG32404-PA 11..104 16..109 287 54.3 Plus
Cpr65Ax1-PA 102 CG34270-PA 4..97 10..109 268 54 Plus