Clone BO14134 Report

Search the DGRC for BO14134

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:141
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptObp99a-RA
Protein status:BO14134.pep: validated full length
Sequenced Size:460

Clone Sequence Records

BO14134.3prime Sequence

458 bp (457 high quality bases) assembled on 2006-05-29

> BO14134.3prime
ATGGTCTAGAAAGCTTGCGGCCTTCGGGGCCAGGCTCTTCTGGATCTGGG
CCAGGTTCTCCTTCAGCAGACAGGTGGCTCCGCGGTAGGCCCACTCGCAG
GCATTGGATCCCTGCTCGTTCTTGTCCACGCAGGCGGCCAAGGAGGCGTG
GAAGGCCTCGTTGTGGTCAGCGTGGTTGCCCACCAGCTGTTGGTGGATGT
TCTCCACGTTGAAACCGCTCTGGACGTCGAACAGGCCCCACTTGGTGAAG
ACGCACTTGATGTAGCACTGGGTCTTGGCGTCGTTGGGGTACTCCCACTT
CTGGTACTTCTCCACCAGATCCACGGGCACGGCCAGCTCCTTGACGCACT
CATCGCGGTAGGCCAGCATGTCGTGTCGGTTCTTCACCACATAGTCGGCG
GAGGCCAGTCCAATCAGCACGCAGATGGCAACGAAAACCTTCATGTCGAC
TGATAACT

BO14134.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG18111-PA 429 Obp99a-RA 1..426 444..19 2130 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 17:51:59
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-RB 561 CG18111-RB 60..485 444..19 2130 100 Minus
Obp99a-RA 610 CG18111-RA 60..485 444..19 2130 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 17:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29671822..29672209 406..19 1940 100 Minus
3R 32079331 3R 29671716..29671755 444..405 200 100 Minus
Blast to na_te.dros performed on 2015-02-10 17:51:56 has no hits.

BO14134.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:19:28 Download gff for BO14134.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18111-PA 1..429 18..444 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:11:58 Download gff for BO14134.3prime
Subject Subject Range Query Range Percent Splice Strand
CG18111-PA 1..429 18..444 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-19 23:13:10 Download gff for BO14134.3prime
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 53..485 19..451 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:05:55 Download gff for BO14134.3prime
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 53..485 19..451 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:05:55 Download gff for BO14134.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 29671709..29671754 406..451 93 -> Minus
3R 29671823..29672209 19..405 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-19 23:13:10 Download gff for BO14134.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25497431..25497476 406..451 93 -> Minus
arm_3R 25497545..25497931 19..405 100   Minus

BO14134.5prime Sequence

458 bp (457 high quality bases) assembled on 2006-05-29

> BO14134.5prime
GAAGTTATCAGTCGACATGAAGGTTTTCGTTGCCATCTGCGTGCTGATTG
GACTGGCCTCCGCCGACTATGTGGTGAAGAACCGACACGACATGCTGGCC
TACCGCGATGAGTGCGTCAAGGAGCTGGCCGTGCCCGTGGATCTGGTGGA
GAAGTACCAGAAGTGGGAGTACCCCAACGACGCCAAGACCCAGTGCTACA
TCAAGTGCGTCTTCACCAAGTGGGGCCTGTTCGACGTCCAGAGCGGTTTC
AACGTGGAGAACATCCACCAACAGCTGGTGGGCAACCACGCTGACCACAA
CGAGGCCTTCCACGCCTCCTTGGCCGCCTGCGTGGACAAGAACGAGCAGG
GATCCAATGCCTGCGAGTGGGCCTACCGCGGAGCCACCTGTCTGCTGAAG
GAGAACCTGGCCCAGATCCAGAAGAGCCTGGCCCCGAAGGCCGCAAGCTT
TCTAGACC

BO14134.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG18111-PA 429 Obp99a-RA 1..426 17..442 2130 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-02 08:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-RB 561 CG18111-RB 60..485 17..442 2130 100 Plus
Obp99a-RA 610 CG18111-RA 60..485 17..442 2130 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-02 08:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29671822..29672209 55..442 1940 100 Plus
3R 32079331 3R 29671716..29671755 17..56 200 100 Plus
Blast to na_te.dros performed on 2015-02-02 08:37:47 has no hits.

BO14134.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:19:30 Download gff for BO14134.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18111-PA 1..429 17..443 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:12:00 Download gff for BO14134.5prime
Subject Subject Range Query Range Percent Splice Strand
CG18111-PA 1..429 17..443 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-08 03:49:17 Download gff for BO14134.5prime
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 53..485 10..442 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-02 09:22:25 Download gff for BO14134.5prime
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 53..485 10..442 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-02 09:22:25 Download gff for BO14134.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 29671709..29671754 10..55 93 -> Plus
3R 29671823..29672209 56..442 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-08 03:49:17 Download gff for BO14134.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25497431..25497476 10..55 93 -> Plus
arm_3R 25497545..25497931 56..442 100   Plus

BO14134.complete Sequence

460 bp assembled on 2006-10-11

GenBank Submission: FJ633027

> BO14134.complete
GAAGTTATCAGTCGACATGAAGGTTTTCGTTGCCATCTGCGTGCTGATTG
GACTGGCCTCCGCCGACTATGTGGTGAAGAACCGACACGACATGCTGGCC
TACCGCGATGAGTGCGTCAAGGAGCTGGCCGTGCCCGTGGATCTGGTGGA
GAAGTACCAGAAGTGGGAGTACCCCAACGACGCCAAGACCCAGTGCTACA
TCAAGTGCGTCTTCACCAAGTGGGGCCTGTTCGACGTCCAGAGCGGTTTC
AACGTGGAGAACATCCACCAACAGCTGGTGGGCAACCACGCTGACCACAA
CGAGGCCTTCCACGCCTCCTTGGCCGCCTGCGTGGACAAGAACGAGCAGG
GATCCAATGCCTGCGAGTGGGCCTACCGCGGAGCCACCTGTCTGCTGAAG
GAGAACCTGGCCCAGATCCAGAAGAGCCTGGCCCCGAAGGCCGCAAGCTT
TCTAGACCAT

BO14134.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:05:40
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-RB 429 CG18111-PB 1..426 17..442 2130 100 Plus
Obp99a-RA 429 CG18111-PA 1..426 17..442 2130 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-RB 561 CG18111-RB 60..485 17..442 2130 100 Plus
Obp99a-RA 610 CG18111-RA 60..485 17..442 2130 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29671822..29672209 55..442 1940 100 Plus
3R 32079331 3R 29671716..29671755 17..56 200 100 Plus
Blast to na_te.dros performed on 2014-11-27 16:05:39 has no hits.

BO14134.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:23:14 Download gff for BO14134.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 1..429 17..443 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:43:08 Download gff for BO14134.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 50..482 10..442 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:49:01 Download gff for BO14134.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 60..485 17..444 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:23:15 Download gff for BO14134.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 50..482 10..442 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:10:21 Download gff for BO14134.complete
Subject Subject Range Query Range Percent Splice Strand
Obp99a-RA 60..485 17..444 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:10:21 Download gff for BO14134.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29671716..29671754 17..55 100 -> Plus
3R 29671823..29672209 56..444 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:49:01 Download gff for BO14134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25497438..25497476 17..55 100 -> Plus
arm_3R 25497545..25497931 56..444 99   Plus

BO14134.pep Sequence

Translation from 16 to 460

> BO14134.pep
MKVFVAICVLIGLASADYVVKNRHDMLAYRDECVKELAVPVDLVEKYQKW
EYPNDAKTQCYIKCVFTKWGLFDVQSGFNVENIHQQLVGNHADHNEAFHA
SLAACVDKNEQGSNACEWAYRGATCLLKENLAQIQKSLAPKAASFLDH

BO14134.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
Obp99a-PB 142 CG18111-PB 1..142 1..142 764 100 Plus
Obp99a-PA 142 CG18111-PA 1..142 1..142 764 100 Plus
Obp99b-PB 149 CG7592-PB 3..147 5..138 290 37.9 Plus
Obp99b-PA 149 CG7592-PA 3..147 5..138 290 37.9 Plus
Obp44a-PB 143 CG2297-PB 5..140 3..138 278 42.3 Plus