BO14141.complete Sequence
364 bp assembled on 2008-11-10
GenBank Submission: KX797081
> BO14141.complete
GAAGTTATCAGTCGACATGGCAGATAAAAAGGTGGGTGGCAACAATGACG
GTAAGGAGAAGCGCCGCAAGGAGTCCATTCTGGACCTCTCCAAGTACTTG
GAGAAACAGATCCGCGTGAAATTCGCGGGCGGCCGCGAGGCATCCGGAAT
CCTCAAGGGCTACGATGCGCTGCTCAATCTGGTGCTGGACAACACGGTGG
AGTATCTGCGCGACTCGGATGAGCCCTACAAACTGACCGAGGAGCAGACC
CGCAGCCTGGGACTGGTCGTCTGTCGCGGCACAGCCCTCGTCCTCATTTG
TCCGCAAGACGGAGTCGAGAGCATCGCCAATCCGTTTATAACGCAAGCAA
GCTTTCTAGACCAT
BO14141.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm7-RB | 333 | CG13277-PB | 1..330 | 17..346 | 1650 | 100 | Plus |
LSm7-RC | 333 | CG13277-PC | 1..330 | 17..346 | 1650 | 100 | Plus |
LSm7-RA | 333 | CG13277-PA | 1..330 | 17..346 | 1650 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm7-RB | 466 | CG13277-RB | 41..370 | 17..346 | 1650 | 100 | Plus |
LSm7-RC | 544 | CG13277-RC | 41..370 | 17..346 | 1650 | 100 | Plus |
LSm7-RA | 705 | CG13277-RA | 41..370 | 17..346 | 1650 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:28:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 16742672..16742988 | 346..30 | 1585 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 10:28:50 has no hits.
BO14141.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:15:51 Download gff for
BO14141.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13277-RA | 23..359 | 9..346 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:09 Download gff for
BO14141.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm7-RA | 41..370 | 17..348 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 17:58:03 Download gff for
BO14141.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13277-RA | 30..359 | 17..348 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:56 Download gff for
BO14141.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
LSm7-RA | 41..370 | 17..348 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:56 Download gff for
BO14141.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 16742670..16742986 | 32..348 | 99 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:09 Download gff for
BO14141.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 16742670..16742986 | 32..348 | 99 | <- | Minus |
BO14141.pep Sequence
Translation from 16 to 364
> BO14141.pep
MADKKVGGNNDGKEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYD
ALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGV
ESIANPFITQASFLDH
BO14141.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:14:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
LSm7-PB | 110 | CG13277-PB | 1..110 | 1..110 | 557 | 100 | Plus |
LSm7-PC | 110 | CG13277-PC | 1..110 | 1..110 | 557 | 100 | Plus |
LSm7-PA | 110 | CG13277-PA | 1..110 | 1..110 | 557 | 100 | Plus |
SmG-PB | 76 | CG9742-PB | 8..76 | 23..100 | 142 | 35.9 | Plus |
SmG-PA | 76 | CG9742-PA | 8..76 | 23..100 | 142 | 35.9 | Plus |