Clone BO14141 Report

Search the DGRC for BO14141

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:141
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptLSm7-RA
Protein status:BO14141.pep: Imported from assembly
Sequenced Size:364

Clone Sequence Records

BO14141.complete Sequence

364 bp assembled on 2008-11-10

GenBank Submission: KX797081

> BO14141.complete
GAAGTTATCAGTCGACATGGCAGATAAAAAGGTGGGTGGCAACAATGACG
GTAAGGAGAAGCGCCGCAAGGAGTCCATTCTGGACCTCTCCAAGTACTTG
GAGAAACAGATCCGCGTGAAATTCGCGGGCGGCCGCGAGGCATCCGGAAT
CCTCAAGGGCTACGATGCGCTGCTCAATCTGGTGCTGGACAACACGGTGG
AGTATCTGCGCGACTCGGATGAGCCCTACAAACTGACCGAGGAGCAGACC
CGCAGCCTGGGACTGGTCGTCTGTCGCGGCACAGCCCTCGTCCTCATTTG
TCCGCAAGACGGAGTCGAGAGCATCGCCAATCCGTTTATAACGCAAGCAA
GCTTTCTAGACCAT

BO14141.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-RB 333 CG13277-PB 1..330 17..346 1650 100 Plus
LSm7-RC 333 CG13277-PC 1..330 17..346 1650 100 Plus
LSm7-RA 333 CG13277-PA 1..330 17..346 1650 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-RB 466 CG13277-RB 41..370 17..346 1650 100 Plus
LSm7-RC 544 CG13277-RC 41..370 17..346 1650 100 Plus
LSm7-RA 705 CG13277-RA 41..370 17..346 1650 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16742672..16742988 346..30 1585 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:28:50 has no hits.

BO14141.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:15:51 Download gff for BO14141.complete
Subject Subject Range Query Range Percent Splice Strand
CG13277-RA 23..359 9..346 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:09 Download gff for BO14141.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 41..370 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-23 17:58:03 Download gff for BO14141.complete
Subject Subject Range Query Range Percent Splice Strand
CG13277-RA 30..359 17..348 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:56 Download gff for BO14141.complete
Subject Subject Range Query Range Percent Splice Strand
LSm7-RA 41..370 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:56 Download gff for BO14141.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16742670..16742986 32..348 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:09 Download gff for BO14141.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16742670..16742986 32..348 99 <- Minus

BO14141.pep Sequence

Translation from 16 to 364

> BO14141.pep
MADKKVGGNNDGKEKRRKESILDLSKYLEKQIRVKFAGGREASGILKGYD
ALLNLVLDNTVEYLRDSDEPYKLTEEQTRSLGLVVCRGTALVLICPQDGV
ESIANPFITQASFLDH

BO14141.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
LSm7-PB 110 CG13277-PB 1..110 1..110 557 100 Plus
LSm7-PC 110 CG13277-PC 1..110 1..110 557 100 Plus
LSm7-PA 110 CG13277-PA 1..110 1..110 557 100 Plus
SmG-PB 76 CG9742-PB 8..76 23..100 142 35.9 Plus
SmG-PA 76 CG9742-PA 8..76 23..100 142 35.9 Plus