Clone BO14157 Report

Search the DGRC for BO14157

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:141
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG30172-RA
Protein status:BO14157.pep: Inserted from web
Sequenced Size:371

Clone Sequence Records

BO14157.5prime Sequence

369 bp (368 high quality bases) assembled on 2006-05-29

> BO14157.5prime
GAAGTTATCAGTCGAACATGCTACTTTTAAATAAAAACCGAGTGATTTCT
TTGGTCGTTAATTTTATTTTTCTTATCATTCTCATTTCATCGAGTGTCCA
AGCGGATGAGAGAAACATTAACAAGCTGCTGAACAACCAGGTGGTGGTCA
GCCGCCAGATTATGTGCATCCTGGGCAAGAGCGAATGCGACCAACTGGGA
CTTCAACTCAAAGCTGCCCTGCCAGAAGTTATAACCAGGAAATGCAGGAA
CTGCTCCCCACAACAGGCTCAAAAAGCGCAAAAGCTGACCACATTTCTGC
AAACTAGATACCCGGACGTATGGGCCATGCTTCTAAGGAAGTACGACAGT
GCCGCAAGCTTTCTAGACC

BO14157.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-PA 339 CG30172-RA 1..336 18..353 1680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-RB 756 CG30172-RB 263..598 18..353 1680 100 Plus
CG30172-RA 431 CG30172-RA 38..373 18..353 1680 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:03:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24030970..24031165 213..18 980 100 Minus
2R 25286936 2R 24030704..24030845 353..212 710 100 Minus
Blast to na_te.dros performed 2015-02-10 22:03:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 774..815 87..46 102 71.4 Minus

BO14157.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:19:58 Download gff for BO14157.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30172-PA 1..339 18..357 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:12:41 Download gff for BO14157.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30172-PA 1..339 18..357 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 00:53:44 Download gff for BO14157.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 38..376 18..357 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:53:32 Download gff for BO14157.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 38..376 18..357 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:53:32 Download gff for BO14157.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 24030700..24030843 214..357 98 <- Minus
2R 24030970..24031165 18..213 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 00:53:44 Download gff for BO14157.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19918223..19918366 214..357 98 <- Minus
arm_2R 19918493..19918688 18..213 100   Minus

BO14157.complete Sequence

371 bp assembled on 2008-08-15

GenBank Submission: KX794912

> BO14157.complete
GAAGTTATCAGTCGAACATGCTACTTTTAAATAAAAACCGAGTGATTTCT
TTGGTCGTTAATTTTATTTTTCTTATCATTCTCATTTCATCGAGTGTCCA
AGCGGATGAGAGAAACATTAACAAGCTGCTGAACAACCAGGTGGTGGTCA
GCCGCCAGATTATGTGCATCCTGGGCAAGAGCGAATGCGACCAACTGGGA
CTTCAACTCAAAGCTGCCCTGCCAGAAGTTATAACCAGGAAATGCAGGAA
CTGCTCCCCACAACAGGCTCAAAAAGCGCAAAAGCTGACCACATTTCTGC
AAACTAGATACCCGGACGTATGGGCCATGCTTCTAAGGAAGTACGACAGT
GCCGCAAGCTTTCTAGACCAT

BO14157.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-RB 339 CG30172-PB 1..336 18..353 1680 100 Plus
CG30172-RA 339 CG30172-PA 1..336 18..353 1680 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-RB 756 CG30172-RB 263..598 18..353 1680 100 Plus
CG30172-RA 431 CG30172-RA 38..373 18..353 1680 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:08:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24030970..24031165 213..18 980 100 Minus
2R 25286936 2R 24030704..24030845 353..212 710 100 Minus
Blast to na_te.dros performed 2014-11-27 10:08:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 774..815 87..46 102 71.4 Minus

BO14157.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:35:36 Download gff for BO14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 37..375 18..357 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:36:11 Download gff for BO14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 37..373 17..355 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-04 11:10:15 Download gff for BO14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 36..372 17..355 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:14:01 Download gff for BO14157.complete
Subject Subject Range Query Range Percent Splice Strand
CG30172-RA 37..373 17..355 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:14:01 Download gff for BO14157.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24030702..24030843 214..355 98 <- Minus
2R 24030970..24031165 17..213 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:36:11 Download gff for BO14157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19918225..19918366 214..355 98 <- Minus
arm_2R 19918493..19918688 17..213 99   Minus

BO14157.pep Sequence

Translation from 17 to 371

> BO14157.pep
MLLLNKNRVISLVVNFIFLIILISSSVQADERNINKLLNNQVVVSRQIMC
ILGKSECDQLGLQLKAALPEVITRKCRNCSPQQAQKAQKLTTFLQTRYPD
VWAMLLRKYDSAASFLDH

BO14157.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG30172-PB 112 CG30172-PB 1..112 1..112 559 100 Plus
CG30172-PA 112 CG30172-PA 1..112 1..112 559 100 Plus
Phk-3-PC 121 CG9358-PC 29..109 30..110 142 30.9 Plus
Phk-3-PB 121 CG9358-PB 29..109 30..110 142 30.9 Plus
Phk-3-PA 121 CG9358-PA 29..109 30..110 142 30.9 Plus