Clone BO14301 Report

Search the DGRC for BO14301

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:143
Well:1
Vector:pDNR-Dual
Associated Gene/TranscriptAtg8b-RA
Protein status:BO14301.pep: validated full length
Sequenced Size:394

Clone Sequence Records

BO14301.3prime Sequence

392 bp (391 high quality bases) assembled on 2006-05-29

> BO14301.3prime
ATGGTCTAGAAAGCTTGCCTGCCGTCCATAGACGTTCTCATCGGTATAGG
AAATGTAGAGGAAGTAGTCCTTGTCGAAGTGCTCCTGGTACAGTGCACCC
ATGGTGGCCGATGTCGGTGGGATCACATTGTTTACGAAGAAGAAGAGGGC
GTCGTCGGGACGCAGATTGATACGCTTGCGGATGAGAAAGTAGAACTGGC
CCACTGTCAGGTCCGCCGGCACCAGGTACTTCTTCTTGTCCAGCTCCGCG
TAACGCGTCTTCGGCGCCTTTTCCACGATGACGGGCACACGGTCCGGATA
CTTGCGCCGGATCTTGTCGCCTTCGTTGCGGCGCTTGTCGAACGAGTGGT
CCTTCTTGTACTGGTAGTTCATATCCATGTCGACTGATAACT

BO14301.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG12334-PA 363 Atg8b-RA 1..360 378..19 1800 100 Minus
CG32672-PA 366 Atg8a-RA 52..98 321..275 160 93.6 Minus
CG32672-PA 366 Atg8a-RA 175..275 198..98 155 86.1 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 15:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 654 CG12334-RB 154..513 378..19 1800 100 Minus
Atg8b-RA 609 CG12334-RA 135..494 378..19 1800 100 Minus
Atg8a-RA 1214 CG32672-RA 269..606 372..35 775 82 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 15:43:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17724551..17724910 19..378 1800 100 Plus
X 23542271 X 10765604..10765802 84..282 470 82.4 Plus
X 23542271 X 10767979..10768070 281..372 235 83.7 Plus
Blast to na_te.dros performed on 2015-02-10 15:43:26 has no hits.

BO14301.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:23:43 Download gff for BO14301.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-PA 1..363 18..378 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:17:55 Download gff for BO14301.3prime
Subject Subject Range Query Range Percent Splice Strand
CG12334-PA 1..363 18..378 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-14 14:56:25 Download gff for BO14301.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..494 19..387 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:06:02 Download gff for BO14301.3prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..494 19..387 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 18:06:02 Download gff for BO14301.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 17724551..17724919 19..387 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-14 14:56:25 Download gff for BO14301.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13550273..13550641 19..387 98   Plus

BO14301.5prime Sequence

392 bp (391 high quality bases) assembled on 2006-05-29

> BO14301.5prime
GAAGTTATCAGTCGACATGGATATGAACTACCAGTACAAGAAGGACCACT
CGTTCGACAAGCGCCGCAACGAAGGCGACAAGATCCGGCGCAAGTATCCG
GACCGTGTGCCCGTCATCGTGGAAAAGGCGCCGAAGACGCGTTACGCGGA
GCTGGACAAGAAGAAGTACCTGGTGCCGGCGGACCTGACAGTGGGCCAGT
TCTACTTTCTCATCCGCAAGCGTATCAATCTGCGTCCCGACGACGCCCTC
TTCTTCTTCGTAAACAATGTGATCCCACCGACATCGGCCACCATGGGTGC
ACTGTACCAGGAGCACTTCGACAAGGACTACTTCCTCTACATTTCCTATA
CCGATGAGAACGTCTATGGACGGCAGGCAAGCTTTCTAGACC

BO14301.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12334-PA 363 Atg8b-RA 1..360 17..376 1800 100 Plus
CG32672-PA 366 Atg8a-RA 52..98 74..120 160 93.6 Plus
CG32672-PA 366 Atg8a-RA 175..275 197..297 155 86.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 654 CG12334-RB 154..513 17..376 1800 100 Plus
Atg8b-RA 609 CG12334-RA 135..494 17..376 1800 100 Plus
Atg8a-RA 1214 CG32672-RA 269..606 23..360 775 82 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17724551..17724910 376..17 1800 100 Minus
X 23542271 X 10765604..10765802 311..113 470 82.4 Minus
X 23542271 X 10767979..10768070 114..23 235 83.7 Minus
Blast to na_te.dros performed on 2015-02-10 20:58:01 has no hits.

BO14301.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:23:44 Download gff for BO14301.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-PA 1..363 17..377 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:17:56 Download gff for BO14301.5prime
Subject Subject Range Query Range Percent Splice Strand
CG12334-PA 1..363 17..377 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 02:37:14 Download gff for BO14301.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..494 8..376 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:36:07 Download gff for BO14301.5prime
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..494 8..376 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:36:07 Download gff for BO14301.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 17724551..17724919 8..376 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 02:37:14 Download gff for BO14301.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13550273..13550641 8..376 98   Minus

BO14301.complete Sequence

394 bp assembled on 2006-10-11

GenBank Submission: FJ633080

> BO14301.complete
GAAGTTATCAGTCGACATGGATATGAACTACCAGTACAAGAAGGACCACT
CGTTCGACAAGCGCCGCAACGAAGGCGACAAGATCCGGCGCAAGTATCCG
GACCGTGTGCCCGTCATCGTGGAAAAGGCGCCGAAGACGCGTTACGCGGA
GCTGGACAAGAAGAAGTACCTGGTGCCGGCGGACCTGACAGTGGGCCAGT
TCTACTTTCTCATCCGCAAGCGTATCAATCTGCGTCCCGACGACGCCCTC
TTCTTCTTCGTAAACAATGTGATCCCACCGACATCGGCCACCATGGGTGC
ACTGTACCAGGAGCACTTCGACAAGGACTACTTCCTCTACATTTCCTATA
CCGATGAGAACGTCTATGGACGGCAGGCAAGCTTTCTAGACCAT

BO14301.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:14:23
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 363 CG12334-PB 1..360 17..376 1800 100 Plus
Atg8b-RA 363 CG12334-PA 1..360 17..376 1800 100 Plus
Atg8a-RA 366 CG32672-PA 1..338 23..360 775 82 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:14:24
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-RB 654 CG12334-RB 154..513 17..376 1800 100 Plus
Atg8b-RA 609 CG12334-RA 135..494 17..376 1800 100 Plus
Atg8a-RA 1214 CG32672-RA 269..606 23..360 775 82 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:14:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17724551..17724910 376..17 1800 100 Minus
X 23542271 X 10765604..10765802 311..113 470 82.4 Minus
X 23542271 X 10767979..10768070 114..23 235 83.7 Minus
Blast to na_te.dros performed on 2014-11-27 07:14:21 has no hits.

BO14301.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:54:03 Download gff for BO14301.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 1..363 17..377 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:04:46 Download gff for BO14301.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..494 8..376 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:09:38 Download gff for BO14301.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 135..494 17..378 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:54:03 Download gff for BO14301.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 126..494 8..376 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:06:24 Download gff for BO14301.complete
Subject Subject Range Query Range Percent Splice Strand
Atg8b-RA 135..494 17..378 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:06:24 Download gff for BO14301.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17724549..17724910 17..378 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:09:38 Download gff for BO14301.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13550271..13550632 17..378 99   Minus

BO14301.pep Sequence

Translation from 16 to 394

> BO14301.pep
MDMNYQYKKDHSFDKRRNEGDKIRRKYPDRVPVIVEKAPKTRYAELDKKK
YLVPADLTVGQFYFLIRKRINLRPDDALFFFVNNVIPPTSATMGALYQEH
FDKDYFLYISYTDENVYGRQASFLDH

BO14301.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Atg8b-PB 120 CG12334-PB 1..120 1..120 641 100 Plus
Atg8b-PA 120 CG12334-PA 1..120 1..120 641 100 Plus
Atg8a-PA 121 CG32672-PA 1..116 3..118 530 82.8 Plus
Atg8a-PC 107 CG32672-PC 7..102 23..118 401 78.1 Plus
Atg8a-PB 96 CG32672-PB 6..91 33..118 395 84.9 Plus