Clone BO14476 Report

Search the DGRC for BO14476

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:144
Well:76
Vector:pDNR-Dual
Associated Gene/Transcriptl(1)G0136-RA
Protein status:BO14476.pep: validated full length
Sequenced Size:424

Clone Sequence Records

BO14476.3prime Sequence

422 bp (421 high quality bases) assembled on 2006-05-29

> BO14476.3prime
ATGGTCTAGAAAGCTTGCCATGCTGAACGATTCGCCGCAGCCGCATGTGC
CCTTAATGTTCGGATTGTTAAACACGAACTCGCTGGACAGCTTCGATTCC
ACAAAGTCCATCTCGGTACCCAGCAGCGACAACTGCGCTTTCTTGTCGAT
GAAGACCTTGACGCCATCCTGGACCACCTCCTCATCCAACTTGTCTTTTT
GGCTGGCATAGTCCAGCGTGTAGGACAGACCATTGCATCCTCGCTGCCGT
ACGCCCACCTTTAGGCCAACCATGTCCGGCTTGTCCTGCAGAAGCGTCTT
GATGCGTAGCACCGCCGCGGGTGTCAGAGTCAGAGCGGCCCGCGTCGGGA
TTAACTTCCGGCCTTTCACCGCCCGCACTGTCGCCGTTGCCACCACACGT
GTCGCCATGTCGACTGATAACT

BO14476.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:22:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG8198-PA 393 l(1)G0136-RA 1..390 408..19 1950 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:57:27
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 780 CG8198-RA 100..489 408..19 1950 100 Minus
l(1)G0136-RB 783 CG8198-RB 100..492 408..19 1910 99.2 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735388..15735489 120..19 510 100 Minus
X 23542271 X 15734369..15734452 408..325 420 100 Minus
X 23542271 X 15735245..15735324 196..117 400 100 Minus
X 23542271 X 15735098..15735174 271..195 385 100 Minus
X 23542271 X 15734552..15734608 325..269 285 100 Minus
Blast to na_te.dros performed on 2015-02-12 06:57:23 has no hits.

BO14476.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:29:08 Download gff for BO14476.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8198-PA 1..393 15..408 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:25:25 Download gff for BO14476.3prime
Subject Subject Range Query Range Percent Splice Strand
CG8198-PA 1..393 15..408 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 17:00:35 Download gff for BO14476.3prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..492 15..412 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:22:38 Download gff for BO14476.3prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..492 15..412 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:22:38 Download gff for BO14476.3prime
Subject Subject Range Query Range Percent Splice Strand
X 15734367..15734452 325..412 97 -> Minus
X 15734553..15734606 271..324 100 -> Minus
X 15735099..15735174 195..270 100 -> Minus
X 15735247..15735321 120..194 100 -> Minus
X 15735389..15735492 15..119 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 17:00:35 Download gff for BO14476.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15628400..15628485 325..412 97 -> Minus
arm_X 15628586..15628639 271..324 100 -> Minus
arm_X 15629132..15629207 195..270 100 -> Minus
arm_X 15629280..15629354 120..194 100 -> Minus
arm_X 15629422..15629525 15..119 98   Minus

BO14476.5prime Sequence

422 bp (421 high quality bases) assembled on 2006-05-29

> BO14476.5prime
GAAGTTATCAGTCGACATGGCGACACGTGTGGTGGCAACGGCGACAGTGC
GGGCGGTGAAAGGCCGGAAGTTAATCCCGACGCGGGCCGCTCTGACTCTG
ACACCCGCGGCGGTGCTACGCATCAAGACGCTTCTGCAGGACAAGCCGGA
CATGGTTGGCCTAAAGGTGGGCGTACGGCAGCGAGGATGCAATGGTCTGT
CCTACACGCTGGACTATGCCAGCCAAAAAGACAAGTTGGATGAGGAGGTG
GTCCAGGATGGCGTCAAGGTCTTCATCGACAAGAAAGCGCAGTTGTCGCT
GCTGGGTACCGAGATGGACTTTGTGGAATCGAAGCTGTCCAGCGAGTTCG
TGTTTAACAATCCGAACATTAAGGGCACATGCGGCTGCGGCGAATCGTTC
AGCATGGCAAGCTTTCTAGACC

BO14476.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:22:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG8198-PA 393 l(1)G0136-RA 1..390 17..406 1950 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 20:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 780 CG8198-RA 100..489 17..406 1950 100 Plus
l(1)G0136-RB 783 CG8198-RB 100..492 17..406 1910 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 20:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735388..15735489 305..406 510 100 Plus
X 23542271 X 15734369..15734452 17..100 420 100 Plus
X 23542271 X 15735245..15735324 229..308 400 100 Plus
X 23542271 X 15735098..15735174 154..230 385 100 Plus
X 23542271 X 15734552..15734608 100..156 285 100 Plus
Blast to na_te.dros performed on 2015-02-10 20:37:56 has no hits.

BO14476.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:29:09 Download gff for BO14476.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8198-PA 1..393 17..410 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:25:26 Download gff for BO14476.5prime
Subject Subject Range Query Range Percent Splice Strand
CG8198-PA 1..393 17..410 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 02:35:37 Download gff for BO14476.5prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..492 13..410 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:01:06 Download gff for BO14476.5prime
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 98..492 13..410 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:01:06 Download gff for BO14476.5prime
Subject Subject Range Query Range Percent Splice Strand
X 15734367..15734452 13..100 97 -> Plus
X 15734553..15734606 101..154 100 -> Plus
X 15735099..15735174 155..230 100 -> Plus
X 15735247..15735321 231..305 100 -> Plus
X 15735389..15735492 306..410 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 02:35:37 Download gff for BO14476.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_X 15628400..15628485 13..100 97 -> Plus
arm_X 15628586..15628639 101..154 100 -> Plus
arm_X 15629132..15629207 155..230 100 -> Plus
arm_X 15629280..15629354 231..305 100 -> Plus
arm_X 15629422..15629525 306..410 98   Plus

BO14476.complete Sequence

424 bp assembled on 2006-10-11

GenBank Submission: FJ638728

> BO14476.complete
GAAGTTATCAGTCGACATGGCGACACGTGTGGTGGCAACGGCGACAGTGC
GGGCGGTGAAAGGCCGGAAGTTAATCCCGACGCGGGCCGCTCTGACTCTG
ACACCCGCGGCGGTGCTACGCATCAAGACGCTTCTGCAGGACAAGCCGGA
CATGGTTGGCCTAAAGGTGGGCGTACGGCAGCGAGGATGCAATGGTCTGT
CCTACACGCTGGACTATGCCAGCCAAAAAGACAAGTTGGATGAGGAGGTG
GTCCAGGATGGCGTCAAGGTCTTCATCGACAAGAAAGCGCAGTTGTCGCT
GCTGGGTACCGAGATGGACTTTGTGGAATCGAAGCTGTCCAGCGAGTTCG
TGTTTAACAATCCGAACATTAAGGGCACATGCGGCTGCGGCGAATCGTTC
AGCATGGCAAGCTTTCTAGACCAT

BO14476.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:05:05
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 393 CG8198-PA 1..390 17..406 1950 100 Plus
l(1)G0136-RB 396 CG8198-PB 1..393 17..406 1885 99.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-RA 780 CG8198-RA 100..489 17..406 1950 100 Plus
l(1)G0136-RB 783 CG8198-RB 100..492 17..406 1885 99.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 17:05:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15735388..15735489 305..406 510 100 Plus
X 23542271 X 15734369..15734452 17..100 420 100 Plus
X 23542271 X 15735245..15735324 229..308 400 100 Plus
X 23542271 X 15735098..15735174 154..230 385 100 Plus
X 23542271 X 15734552..15734608 100..156 285 100 Plus
Blast to na_te.dros performed on 2014-11-27 17:05:04 has no hits.

BO14476.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:54:01 Download gff for BO14476.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 1..393 17..410 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:04:45 Download gff for BO14476.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 88..482 13..410 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:01:00 Download gff for BO14476.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 100..489 17..408 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:54:02 Download gff for BO14476.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 88..482 13..410 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:34:16 Download gff for BO14476.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0136-RA 100..489 17..408 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:34:16 Download gff for BO14476.complete
Subject Subject Range Query Range Percent Splice Strand
X 15734553..15734606 101..154 100 -> Plus
X 15735099..15735174 155..230 100 -> Plus
X 15735247..15735321 231..305 100 -> Plus
X 15735389..15735489 306..408 98   Plus
X 15734369..15734452 17..100 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:01:00 Download gff for BO14476.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15628402..15628485 17..100 100 -> Plus
arm_X 15628586..15628639 101..154 100 -> Plus
arm_X 15629132..15629207 155..230 100 -> Plus
arm_X 15629280..15629354 231..305 100 -> Plus
arm_X 15629422..15629522 306..408 98   Plus

BO14476.pep Sequence

Translation from 16 to 424

> BO14476.pep
MATRVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLK
VGVRQRGCNGLSYTLDYASQKDKLDEEVVQDGVKVFIDKKAQLSLLGTEM
DFVESKLSSEFVFNNPNIKGTCGCGESFSMASFLDH

BO14476.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0136-PA 130 CG8198-PA 1..130 1..130 651 100 Plus
l(1)G0136-PB 131 CG8198-PB 1..131 1..130 639 99.2 Plus