Clone BO14748 Report

Search the DGRC for BO14748

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:147
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptVha13-RA
Protein status:BO14748.pep: validated full length
Sequenced Size:385

Clone Sequence Records

BO14748.5prime Sequence

383 bp (383 high quality bases) assembled on 2006-06-16

> BO14748.5prime
GAAGTTATCAGTCGACATGGCCAGCCAGACGCAGGGAATCCAGCAGTTGC
TCGCTGCCGAGAAAAAGGCAGCCGAGAAGGTCGCCGAGGCTCGTAAACGC
AAGGCAAGGAGGTTGAAGCAAGCCAAGGACGAGGCTACCGAGGAGATCGA
GAAGTTCCGCCAGGAGCGCGAGCGCGCCTTCAAGGAGTTCGAGGCCAAGC
ACATGGGAAGTCGCGAGGGCGTGGCGGCCAAGATCGATGCGGATATCCGC
GTTAAGCTGGCCGACATGGACCGGGCCATCCAGACCCGCAAGGACCCGTT
CATCCTGGAGATCCTGCAGTACGTGTACAACATCTCGCCCGAGGTGCACA
AAAACTACAACCACAAGGCAAGCTTTCTAGACC

BO14748.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6213-PA 354 Vha13-RA 1..351 17..367 1730 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 11:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-RB 943 CG6213-RB 100..450 17..367 1740 99.7 Plus
Vha13-RA 703 CG6213-RA 100..450 17..367 1740 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 11:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19643511..19643680 367..198 835 99.4 Minus
3R 32079331 3R 19643738..19643838 199..99 505 100 Minus
3R 32079331 3R 19644201..19644287 103..17 420 98.9 Minus
Blast to na_te.dros performed on 2015-02-12 11:33:18 has no hits.

BO14748.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:35:15 Download gff for BO14748.5prime
Subject Subject Range Query Range Percent Splice Strand
Vha13-PA 1..354 17..371 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:33:58 Download gff for BO14748.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6213-PA 1..354 17..371 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 05:08:43 Download gff for BO14748.5prime
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 100..455 17..372 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:40:24 Download gff for BO14748.5prime
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 100..455 17..372 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 13:40:24 Download gff for BO14748.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 19643506..19643678 200..372 98 <- Minus
3R 19643738..19643838 99..199 100 <- Minus
3R 19644206..19644287 17..98 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 05:08:43 Download gff for BO14748.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15469228..15469400 200..372 98 <- Minus
arm_3R 15469460..15469560 99..199 100 <- Minus
arm_3R 15469928..15470009 17..98 100   Minus

BO14748.3prime Sequence

383 bp (382 high quality bases) assembled on 2006-06-02

> BO14748.3prime
ATGGTCTAGAAAGCTTGCCTTGTGGTTGTAGTTTTTGTGCACCTCGGGCG
AGATGTTGTACACGTACTGCAGGATCTCCAGGATGAACGGGTCCTTGCGG
GTCTGGATGGCCCGGTCCATGTCGGCCAGCTTAACGCGGATATCCGCATC
GATCTTGGCCGCCACGCCCTCGCGACTTCCCATGTGCTTGGCCTCGAACT
CCTTGAAGGCGCGCTCGCGCTCCTGGCGGAACTTCTCGATCTCCTCGGTA
GCCTCGTCCTTGGCTTGCTTCAACCTCCTTGCCTTGCGTTTACGAGCCTC
GGCGACCTTCTCGGCTGCCTTTTTCTCGGCAGCGAGCAACTGCTGGATTC
CCTGCGTCTGGCTGGCCATGTCGACTGATAACT

BO14748.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:27:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6213-PA 354 Vha13-RA 1..351 369..19 1730 99.7 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:21:58
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-RB 943 CG6213-RB 100..450 369..19 1740 99.7 Minus
Vha13-RA 703 CG6213-RA 100..450 369..19 1740 99.7 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:21:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19643511..19643680 19..188 835 99.4 Plus
3R 32079331 3R 19643738..19643838 187..287 505 100 Plus
3R 32079331 3R 19644201..19644287 283..369 420 98.9 Plus
Blast to na_te.dros performed on 2015-02-10 18:21:57 has no hits.

BO14748.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:35:14 Download gff for BO14748.3prime
Subject Subject Range Query Range Percent Splice Strand
Vha13-PA 1..354 15..369 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:33:56 Download gff for BO14748.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6213-PA 1..354 15..369 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:47:19 Download gff for BO14748.3prime
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 100..455 14..369 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:40:53 Download gff for BO14748.3prime
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 100..455 14..369 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:40:53 Download gff for BO14748.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 19643506..19643678 14..186 98 <- Plus
3R 19643738..19643838 187..287 100 <- Plus
3R 19644206..19644287 288..369 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:47:19 Download gff for BO14748.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15469228..15469400 14..186 98 <- Plus
arm_3R 15469460..15469560 187..287 100 <- Plus
arm_3R 15469928..15470009 288..369 100   Plus

BO14748.complete Sequence

385 bp (385 high quality bases) assembled on 2006-06-21

GenBank Submission: FJ633235

> BO14748.complete
GAAGTTATCAGTCGACATGGCCAGCCAGACGCAGGGAATCCAGCAGTTGC
TCGCTGCCGAGAAAAAGGCAGCCGAGAAGGTCGCCGAGGCTCGTAAACGC
AAGGCAAGGAGGTTGAAGCAAGCCAAGGACGAGGCTACCGAGGAGATCGA
GAAGTTCCGCCAGGAGCGCGAGCGCGCCTTCAAGGAGTTCGAGGCCAAGC
ACATGGGAAGTCGCGAGGGCGTGGCGGCCAAGATCGATGCGGATATCCGC
GTTAAGCTGGCCGACATGGACCGGGCCATCCAGACCCGCAAGGACCCGTT
CATCCTGGAGATCCTGCAGTACGTGTACAACATCTCGCCCGAGGTGCACA
AAAACTACAACCACAAGGCAAGCTTTCTAGACCAT

BO14748.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-RB 354 CG6213-PB 1..351 17..367 1740 99.7 Plus
Vha13-RA 354 CG6213-PA 1..351 17..367 1740 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-RB 943 CG6213-RB 100..450 17..367 1740 99.7 Plus
Vha13-RA 703 CG6213-RA 100..450 17..367 1740 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19643511..19643680 367..198 835 99.4 Minus
3R 32079331 3R 19643738..19643838 199..99 505 100 Minus
3R 32079331 3R 19644201..19644287 103..17 420 98.9 Minus
Blast to na_te.dros performed on 2014-11-27 20:55:54 has no hits.

BO14748.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:57:18 Download gff for BO14748.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 1..354 17..371 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:29:55 Download gff for BO14748.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 126..481 17..372 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:15:42 Download gff for BO14748.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 100..450 17..369 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:57:18 Download gff for BO14748.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 126..481 17..372 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:31:11 Download gff for BO14748.complete
Subject Subject Range Query Range Percent Splice Strand
Vha13-RA 100..450 17..369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:31:11 Download gff for BO14748.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19643509..19643678 200..369 98 <- Minus
3R 19643738..19643838 99..199 100 <- Minus
3R 19644206..19644287 17..98 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:15:42 Download gff for BO14748.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15469231..15469400 200..369 98 <- Minus
arm_3R 15469460..15469560 99..199 100 <- Minus
arm_3R 15469928..15470009 17..98 100   Minus

BO14748.pep Sequence

Translation from 16 to 385

> BO14748.pep
MASQTQGIQQLLAAEKKAAEKVAEARKRKARRLKQAKDEATEEIEKFRQE
RERAFKEFEAKHMGSREGVAAKIDADIRVKLADMDRAIQTRKDPFILEIL
QYVYNISPEVHKNYNHKASFLDH

BO14748.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Vha13-PB 117 CG6213-PB 1..117 1..117 581 100 Plus
Vha13-PA 117 CG6213-PA 1..117 1..117 581 100 Plus