Clone BO15012 Report

Search the DGRC for BO15012

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:150
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptCG5039-RA
Protein status:BO15012.pep: validated full length
Sequenced Size:367

Clone Sequence Records

BO15012.3prime Sequence

365 bp (365 high quality bases) assembled on 2006-06-16

> BO15012.3prime
ATGGTCTAGAAAGCTTGCGGCATTGGAGGCGTTATTCGCTCCATCCTGAA
TGTGGAGGCGACCAGTGAGGAGAGTAGCAGTAGTCCTTTGATCTCCCAGT
TCATCTCCGCAGTCCATGGGCACATCGGAATCCTCCTCATCCACATTGAT
GTATCCACTTCGCGGAGCCTTCCTGCTCTTTAGGCAATCCCAGGAATTCC
GACAGCGACTACGTGACATGGCGTAGACCAGTGCAGCCAGAACGAAAATG
CCAACGAGCACGGAAATTGGCAGCCATATGTATTGACCGTCGTCCGGATG
CAGTATGTCCGGTTCAGGACTAATGGTCGTCTGAGGCTCAAGTAACTTCA
TGTCGACTGATAACT

BO15012.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-PA 336 CG5039-RA 1..333 351..19 1665 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:11:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-RA 719 CG5039-RA 95..427 351..19 1665 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 13:11:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25678968..25679159 233..42 945 99.5 Minus
3R 32079331 3R 25678777..25678901 351..227 625 100 Minus
Blast to na_te.dros performed on 2015-02-08 13:11:24 has no hits.

BO15012.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:40:30 Download gff for BO15012.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-PA 1..336 18..351 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:41:12 Download gff for BO15012.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-PA 1..336 18..351 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:50:04 Download gff for BO15012.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 95..427 19..351 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:53:20 Download gff for BO15012.3prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 95..427 19..351 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:53:20 Download gff for BO15012.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 25678777..25678899 229..351 100 -> Minus
3R 25678973..25679158 43..228 100 -> Minus
3R 25679214..25679237 19..42 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:50:04 Download gff for BO15012.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21504695..21504880 43..228 100 -> Minus
arm_3R 21504936..21504959 19..42 100   Minus
arm_3R 21504499..21504621 229..351 100 -> Minus

BO15012.5prime Sequence

365 bp (365 high quality bases) assembled on 2006-06-16

> BO15012.5prime
GAAGTTATCCTTCGACATGAAGTTACTTGAGCCTCAGACGACCATTAGTC
CTGAACCGGACATACTGCATCCGGACGACGGTCAATACATATGGCTGCCA
ATTTCCGTGCTCGTTGGCATTTTCGTTCTGGCTGCACTGGTCTACGCCAT
GTCACGTAGTCGCTGTCGGAATTCCTGGGATTGCCTAAAGAGCAGGAAGG
CTCCGCGAAGTGGATACATCAATGTGGATGAGGAGGATTCCGATGTGCCC
ATGGACTGCGGAGATGAACTGGGAGATCAAAGGACTACTGCTACTCTCCT
CACTGGTCGCCTCCACATTCAGGATGGAGCGAATAACGCCTCCAATGCCG
CAAGCTTTCTAGACC

BO15012.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:30:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-PA 336 CG5039-RA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 22:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-RA 719 CG5039-RA 95..427 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 22:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25678968..25679159 135..326 945 99.5 Plus
3R 32079331 3R 25678777..25678901 17..141 625 100 Plus
Blast to na_te.dros performed on 2015-02-09 22:44:47 has no hits.

BO15012.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:40:31 Download gff for BO15012.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-PA 1..336 17..350 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:41:14 Download gff for BO15012.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-PA 1..336 17..350 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 08:23:05 Download gff for BO15012.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 95..427 17..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 00:48:15 Download gff for BO15012.5prime
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 95..427 17..349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 00:48:15 Download gff for BO15012.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 25678777..25678899 17..139 100 -> Plus
3R 25678973..25679158 140..325 100 -> Plus
3R 25679214..25679237 326..349 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 08:23:05 Download gff for BO15012.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21504499..21504621 17..139 100 -> Plus
arm_3R 21504695..21504880 140..325 100 -> Plus
arm_3R 21504936..21504959 326..349 100   Plus

BO15012.complete Sequence

367 bp (367 high quality bases) assembled on 2006-06-21

GenBank Submission: FJ633326

> BO15012.complete
GAAGTTATCAGTCGACATGAAGTTACTTGAGCCTCAGACGACCATTAGTC
CTGAACCGGACATACTGCATCCGGACGACGGTCAATACATATGGCTGCCA
ATTTCCGTGCTCGTTGGCATTTTCGTTCTGGCTGCACTGGTCTACGCCAT
GTCACGTAGTCGCTGTCGGAATTCCTGGGATTGCCTAAAGAGCAGGAAGG
CTCCGCGAAGTGGATACATCAATGTGGATGAGGAGGATTCCGATGTGCCC
ATGGACTGCGGAGATGAACTGGGAGATCAAAGGACTACTGCTACTCTCCT
CACTGGTCGCCTCCACATTCAGGATGGAGCGAATAACGCCTCCAATGCCG
CAAGCTTTCTAGACCAT

BO15012.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-RA 336 CG5039-PA 1..333 17..349 1665 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-RA 719 CG5039-RA 95..427 17..349 1665 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:11:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25678968..25679159 135..326 945 99.5 Plus
3R 32079331 3R 25678777..25678901 17..141 625 100 Plus
Blast to na_te.dros performed on 2014-11-27 01:11:46 has no hits.

BO15012.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:16:50 Download gff for BO15012.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 1..336 17..350 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:35:23 Download gff for BO15012.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 66..398 17..349 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:42 Download gff for BO15012.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 95..427 17..351 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:16:50 Download gff for BO15012.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 66..398 17..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:20:28 Download gff for BO15012.complete
Subject Subject Range Query Range Percent Splice Strand
CG5039-RA 95..427 17..351 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:20:28 Download gff for BO15012.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25678777..25678899 17..139 100 -> Plus
3R 25678973..25679158 140..325 100 -> Plus
3R 25679214..25679237 326..351 92   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:42 Download gff for BO15012.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21504499..21504621 17..139 100 -> Plus
arm_3R 21504695..21504880 140..325 100 -> Plus
arm_3R 21504936..21504959 326..351 92   Plus

BO15012.pep Sequence

Translation from 16 to 367

> BO15012.pep
MKLLEPQTTISPEPDILHPDDGQYIWLPISVLVGIFVLAALVYAMSRSRC
RNSWDCLKSRKAPRSGYINVDEEDSDVPMDCGDELGDQRTTATLLTGRLH
IQDGANNASNAASFLDH

BO15012.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG5039-PA 111 CG5039-PA 1..111 1..111 587 100 Plus