Clone BO15154 Report

Search the DGRC for BO15154

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:151
Well:54
Vector:pDNR-Dual
Associated Gene/TranscriptCG32284-RA
Protein status:BO15154.pep: validated full length
Sequenced Size:340

Clone Sequence Records

BO15154.3prime Sequence

338 bp (338 high quality bases) assembled on 2006-06-16

> BO15154.3prime
ATGGTCTAGAAAGCTTGCGTTGGTTGGTGCCATTGCAGAACATTCATCTG
GAACTTCAGACCGGCACATTTTCAAATTGGGATCAAAGTACTGGTTCACT
TTGCAGCTCTTAATCAACGACAAAACTGATCCATTGACCACGTAACAATA
AACGTAGGTTCTACAAGTTGGATCAGCCTGGTTTTCCATTATGGTGGTGG
TTGTAACTTCGCTGCAGGCTTCTTCCGCACTCCAAGTCTTCGAGTTGTGG
TCGTCAAACTCTGGAGCTGGCAAAGCCGTGAGGCAATGAGCCAGCAACAG
TAAAAACATTATACGCAGCCACATGTCGACTGATAACT

BO15154.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 309 CG32284-RA 1..306 324..19 1530 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 457 CG32284-RA 7..313 325..19 1535 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 06:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3186759..3186899 298..158 705 100 Minus
3L 28110227 3L 3186963..3187101 157..19 695 100 Minus
Blast to na_te.dros performed on 2015-02-12 06:58:53 has no hits.

BO15154.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:42:45 Download gff for BO15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 15..324 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:44:13 Download gff for BO15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 15..324 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-29 17:00:43 Download gff for BO15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..316 15..327 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 08:31:14 Download gff for BO15154.3prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..316 15..327 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 08:31:14 Download gff for BO15154.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 3186670..3186697 298..325 100 -> Minus
3L 3186760..3186899 158..297 100 -> Minus
3L 3186963..3187104 15..157 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-29 17:00:43 Download gff for BO15154.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3186670..3186697 298..325 100 -> Minus
arm_3L 3186760..3186899 158..297 100 -> Minus
arm_3L 3186963..3187104 15..157 98   Minus

BO15154.5prime Sequence

338 bp (338 high quality bases) assembled on 2006-06-16

> BO15154.5prime
GAAGTTATCAGTCGACATGTGGCTGCGTATAATGTTTTTACTGTTGCTGG
CTCATTGCCTCACGGCTTTGCCAGCTCCAGAGTTTGACGACCACAACTCG
AAGACTTGGAGTGCGGAAGAAGCCTGCAGCGAAGTTACAACCACCACCAT
AATGGAAAACCAGGCTGATCCAACTTGTAGAACCTACGTTTATTGTTACG
TGGTCAATGGATCAGTTTTGTCGTTGATTAAGAGCTGCAAAGTGAACCAG
TACTTTGATCCCAATTTGAAAATGTGCCGGTCTGAAGTTCCAGATGAATG
TTCTGCAATGGCACCAACCAACGCAAGCTTTCTAGACC

BO15154.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 309 CG32284-RA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 19:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 457 CG32284-RA 7..313 16..322 1535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 19:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3186759..3186899 43..183 705 100 Plus
3L 28110227 3L 3186963..3187101 184..322 695 100 Plus
Blast to na_te.dros performed on 2015-02-12 19:53:44 has no hits.

BO15154.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:42:46 Download gff for BO15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 17..326 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:44:14 Download gff for BO15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-PA 1..309 17..326 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 10:32:16 Download gff for BO15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..316 14..326 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 01:03:38 Download gff for BO15154.5prime
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..316 14..326 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 01:03:38 Download gff for BO15154.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 3186670..3186697 16..43 100 -> Plus
3L 3186760..3186899 44..183 100 -> Plus
3L 3186963..3187104 184..326 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 10:32:16 Download gff for BO15154.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3186670..3186697 16..43 100 -> Plus
arm_3L 3186760..3186899 44..183 100 -> Plus
arm_3L 3186963..3187104 184..326 98   Plus

BO15154.complete Sequence

340 bp (340 high quality bases) assembled on 2006-06-21

GenBank Submission: FJ633366

> BO15154.complete
GAAGTTATCAGTCGACATGTGGCTGCGTATAATGTTTTTACTGTTGCTGG
CTCATTGCCTCACGGCTTTGCCAGCTCCAGAGTTTGACGACCACAACTCG
AAGACTTGGAGTGCGGAAGAAGCCTGCAGCGAAGTTACAACCACCACCAT
AATGGAAAACCAGGCTGATCCAACTTGTAGAACCTACGTTTATTGTTACG
TGGTCAATGGATCAGTTTTGTCGTTGATTAAGAGCTGCAAAGTGAACCAG
TACTTTGATCCCAATTTGAAAATGTGCCGGTCTGAAGTTCCAGATGAATG
TTCTGCAATGGCACCAACCAACGCAAGCTTTCTAGACCAT

BO15154.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:57:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 309 CG32284-PA 1..306 17..322 1530 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-RA 457 CG32284-RA 7..313 16..322 1535 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3186759..3186899 43..183 705 100 Plus
3L 28110227 3L 3186963..3187101 184..322 695 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:57:32 has no hits.

BO15154.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:16:13 Download gff for BO15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..309 17..326 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:34:33 Download gff for BO15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..316 14..326 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:36:40 Download gff for BO15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 8..313 17..324 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:16:13 Download gff for BO15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 1..316 14..326 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:30:45 Download gff for BO15154.complete
Subject Subject Range Query Range Percent Splice Strand
CG32284-RA 8..313 17..324 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:30:45 Download gff for BO15154.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3186671..3186697 17..43 100 -> Plus
3L 3186760..3186899 44..183 100 -> Plus
3L 3186963..3187101 184..324 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:36:40 Download gff for BO15154.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3186671..3186697 17..43 100 -> Plus
arm_3L 3186760..3186899 44..183 100 -> Plus
arm_3L 3186963..3187101 184..324 98   Plus

BO15154.pep Sequence

Translation from 16 to 340

> BO15154.pep
MWLRIMFLLLLAHCLTALPAPEFDDHNSKTWSAEEACSEVTTTTIMENQA
DPTCRTYVYCYVVNGSVLSLIKSCKVNQYFDPNLKMCRSEVPDECSAMAP
TNASFLDH

BO15154.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 21:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG32284-PA 102 CG32284-PA 1..102 1..102 555 100 Plus
CG14957-PA 96 CG14957-PA 1..95 1..95 254 50.5 Plus
CG42494-PC 283 CG42494-PC 215..283 28..96 232 55.1 Plus
CG42494-PB 283 CG42494-PB 215..283 28..96 232 55.1 Plus
CG42494-PA 283 CG42494-PA 215..283 28..96 232 55.1 Plus
CG42494-PC 283 CG42494-PC 123..197 31..104 165 40 Plus
CG42494-PB 283 CG42494-PB 123..197 31..104 165 40 Plus