Clone BO15191 Report

Search the DGRC for BO15191

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:151
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptTsp66A-RA
Protein status:BO15191.pep: validated full length
Sequenced Size:343

Clone Sequence Records

BO15191.3prime Sequence

341 bp (341 high quality bases) assembled on 2006-06-16

> BO15191.3prime
ATGGTCTAGAAAGCTTGCACAGGATAATAAGGAATACCTCAATGCATATG
ACTGAATTACGAAGGAGATCACATGGATGATGGGCGACGCGGGCTTTATG
GAGCGCGTGGAGCAGCCTGATCGGTACAGGTCCTCATCCCTTTCACTGCC
ATTCTTGTAACAGGATTTTGGGATATTCAGATCGCCCAACTTGTAGTCGT
CAGGTCCCAAAACTCCGCAGCACTGGCAGCGACTTTCGTAGAATTCCAAA
CTCTTGCGATTCATCCATATTCGAAGTACATCTCCAACAATTTGGTACTG
TTGTGCAAACAGTATAGTCAGCATCATGTCGACTGATAACT

BO15191.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:33:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG16991-PA 312 Tsp66A-RA 1..309 327..19 1545 100 Minus
CG16991-PB 648 Tsp66A-RB 256..532 327..51 1385 100 Minus
CG16991-PB 648 Tsp66A-RB 540..574 53..19 175 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-08 12:58:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 2597 CG42661-RB 1659..1977 327..19 1435 96.9 Minus
CG42661-RA 2531 CG42661-RA 1593..1911 327..19 1435 96.9 Minus
CG42660-RB 2597 CG42660-RB 1659..1977 327..19 1435 96.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-08 12:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7467920..7468096 228..52 885 100 Minus
3L 28110227 3L 7467760..7467858 327..229 495 100 Minus
Blast to na_te.dros performed 2015-02-08 12:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 4216..4286 92..162 103 60.6 Plus

BO15191.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:43:20 Download gff for BO15191.3prime
Subject Subject Range Query Range Percent Splice Strand
CG16991-PA 1..312 15..327 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:44:59 Download gff for BO15191.3prime
Subject Subject Range Query Range Percent Splice Strand
CG16991-PA 1..312 15..327 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-11 23:48:01 Download gff for BO15191.3prime
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 220..532 14..327 99   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-08 13:51:40 Download gff for BO15191.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42660-RB 1659..1981 14..327 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-08 13:51:40 Download gff for BO15191.3prime
Subject Subject Range Query Range Percent Splice Strand
3L 7467760..7467858 229..327 100 -> Minus
3L 7467920..7468096 52..228 100 -> Minus
3L 7468156..7468192 14..51 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-11 23:48:01 Download gff for BO15191.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7460860..7460958 229..327 100 -> Minus
arm_3L 7461020..7461196 52..228 100 -> Minus
arm_3L 7461256..7461292 14..51 94   Minus

BO15191.5prime Sequence

341 bp (341 high quality bases) assembled on 2006-06-16

> BO15191.5prime
GAAGTTATCAGTCGACATGATGCTGACTATACTGTTTGCACAACAGTACC
AAATTGTTGGAGATGTACTTCGAATATGGATGAATCGCAAGAGTTTGGAA
TTCTACGAAAGTCGCTGCCAGTGCTGCGGAGTTTTGGGACCTGACGACTA
CAAGTTGGGCGATCTGAATATCCCAAAATCCTGTTACAAGAATGGCAGTG
AAAGGGATGAGGACCTGTACCGATCAGGCTGCTCCACGCGCTCCATAAAG
CCCGCGTCGCCCATCATCCATGTGATCTCCTTCGTAATTCAGTCATATGC
ATTGAGGTATTCCTTATTATCCTGTGCAAGCTTTCTAGACC

BO15191.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG16991-PA 312 Tsp66A-RA 1..309 17..325 1545 100 Plus
CG16991-PB 648 Tsp66A-RB 256..532 17..293 1385 100 Plus
CG16991-PB 648 Tsp66A-RB 540..574 291..325 175 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 2597 CG42661-RB 1659..1977 17..325 1435 96.9 Plus
CG42661-RA 2531 CG42661-RA 1593..1911 17..325 1435 96.9 Plus
CG42660-RB 2597 CG42660-RB 1659..1977 17..325 1435 96.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7467920..7468096 116..292 885 100 Plus
3L 28110227 3L 7467760..7467858 17..115 495 100 Plus
Blast to na_te.dros performed 2015-02-10 21:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 4216..4286 252..182 103 60.6 Minus

BO15191.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:43:21 Download gff for BO15191.5prime
Subject Subject Range Query Range Percent Splice Strand
CG16991-PA 1..312 17..329 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:45:01 Download gff for BO15191.5prime
Subject Subject Range Query Range Percent Splice Strand
CG16991-PA 1..312 17..329 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 00:51:06 Download gff for BO15191.5prime
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 220..532 17..330 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:51:06 Download gff for BO15191.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42660-RB 1659..1981 17..330 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:51:06 Download gff for BO15191.5prime
Subject Subject Range Query Range Percent Splice Strand
3L 7467920..7468096 116..292 100 -> Plus
3L 7468156..7468192 293..330 94   Plus
3L 7467760..7467858 17..115 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 00:51:06 Download gff for BO15191.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7460860..7460958 17..115 100 -> Plus
arm_3L 7461020..7461196 116..292 100 -> Plus
arm_3L 7461256..7461292 293..330 94   Plus

BO15191.complete Sequence

343 bp (343 high quality bases) assembled on 2006-06-21

GenBank Submission: FJ633379

> BO15191.complete
GAAGTTATCAGTCGACATGATGCTGACTATACTGTTTGCACAACAGTACC
AAATTGTTGGAGATGTACTTCGAATATGGATGAATCGCAAGAGTTTGGAA
TTCTACGAAAGTCGCTGCCAGTGCTGCGGAGTTTTGGGACCTGACGACTA
CAAGTTGGGCGATCTGAATATCCCAAAATCCTGTTACAAGAATGGCAGTG
AAAGGGATGAGGACCTGTACCGATCAGGCTGCTCCACGCGCTCCATAAAG
CCCGCGTCGCCCATCATCCATGTGATCTCCTTCGTAATTCAGTCATATGC
ATTGAGGTATTCCTTATTATCCTGTGCAAGCTTTCTAGACCAT

BO15191.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-RC 711 CG16991-PC 319..637 17..325 1410 96.9 Plus
Tsp66A-RD 711 CG16991-PD 319..637 17..325 1410 96.9 Plus
Tsp66A-RE 717 CG16991-PE 325..643 17..325 1410 96.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RB 2597 CG42661-RB 1659..1977 17..325 1410 96.9 Plus
CG42661-RA 2531 CG42661-RA 1593..1911 17..325 1410 96.9 Plus
CG42660-RB 2597 CG42660-RB 1659..1977 17..325 1410 96.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7467920..7468096 116..292 885 100 Plus
3L 28110227 3L 7467760..7467858 17..115 495 100 Plus
Blast to na_te.dros performed 2014-11-27 14:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ninja 6644 Dsim\ninja DSRN 6644bp Derived from D83207 (Rel. 53, Last updated, Version 4). 4216..4286 252..182 103 60.6 Minus

BO15191.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:54:41 Download gff for BO15191.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 1..312 17..329 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:26:57 Download gff for BO15191.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 220..532 17..330 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:32:39 Download gff for BO15191.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 220..528 17..327 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:54:41 Download gff for BO15191.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RA 220..532 17..330 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:52:18 Download gff for BO15191.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RB 1659..1977 17..327 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:52:18 Download gff for BO15191.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7467760..7467858 17..115 100 -> Plus
3L 7467920..7468096 116..292 100 -> Plus
3L 7468156..7468188 293..327 94   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:32:39 Download gff for BO15191.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7460860..7460958 17..115 100 -> Plus
arm_3L 7461020..7461196 116..292 100 -> Plus
arm_3L 7461256..7461288 293..327 94   Plus

BO15191.pep Sequence

Translation from 16 to 343

> BO15191.pep
MMLTILFAQQYQIVGDVLRIWMNRKSLEFYESRCQCCGVLGPDDYKLGDL
NIPKSCYKNGSERDEDLYRSGCSTRSIKPASPIIHVISFVIQSYALRYSL
LSCASFLDH

BO15191.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-PC 236 CG16991-PC 107..204 1..103 493 92.2 Plus
Tsp66A-PD 236 CG16991-PD 107..204 1..103 493 92.2 Plus
Tsp66A-PE 238 CG16991-PE 109..206 1..103 493 92.2 Plus
Tsp66A-PF 234 CG16991-PF 107..202 1..103 466 90.3 Plus