Clone BO15374 Report

Search the DGRC for BO15374

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:153
Well:74
Vector:pDNR-Dual
Associated Gene/Transcriptl(3)87Df-RA
Protein status:BO15374.pep: validated full length
Sequenced Size:364

Clone Sequence Records

BO15374.3prime Sequence

362 bp (361 high quality bases) assembled on 2006-06-16

> BO15374.3prime
ATGGTCTAGAAAGCTTGCCGCCGACTTCAGATCTAAGTCTCTCTCCCTTT
GGGTGCCCTCATAAAGGGCTTGTCGTCTCATCGCCTCACGCAATTGCTGC
TGCTCGAATCTCCTGACGGACCATTGATACCTGCAGGTCATCCAGTAGGC
GATGGTGCCGCAAAAGAAGGAGCCGAAGCCCACGTGGGTGGACAGGTGGG
TTCGCGAGGTGCCCAGAAAAGTCAGCAAGCCGATGCCGATCCCTCCGCTG
ATTCCGTAGAGAAAACTGTTACGAAAGCACGGGATCTGCGCCACATCGCG
TCCGAAGATAACGAAGCTCTTGGCGGGTTCCTCGGGTTCTTCGGCCATGT
CGACTGATAACT

BO15374.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:35:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG7620-PA 333 l(3)87Df-RA 1..330 348..19 1600 99.3 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 03:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 551 CG7620-RA 69..399 349..19 1625 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 03:34:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13031080..13031272 320..128 935 99 Minus
3R 32079331 3R 13031331..13031446 134..19 580 100 Minus
Blast to na_te.dros performed on 2015-02-12 03:34:34 has no hits.

BO15374.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:46:22 Download gff for BO15374.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 18..348 98   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:48:57 Download gff for BO15374.3prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 18..348 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-28 21:39:34 Download gff for BO15374.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..403 13..349 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 06:37:57 Download gff for BO15374.3prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..403 13..349 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 06:37:57 Download gff for BO15374.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 13031335..13031450 13..130 97   Minus
3R 13030981..13031011 319..349 100 -> Minus
3R 13031082..13031269 131..318 98 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-28 21:39:34 Download gff for BO15374.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8856703..8856733 319..349 100 -> Minus
arm_3R 8856804..8856991 131..318 98 -> Minus
arm_3R 8857057..8857172 13..130 97   Minus

BO15374.5prime Sequence

362 bp (361 high quality bases) assembled on 2006-06-16

> BO15374.5prime
GAAGTTATCAGTCGACATGGCCGAAGAACCCGAGGAACCCGCCAAGAGCT
TCGTTATCTTCGGACGCGATGTGGCGCAGATCCCGTGCTTTCGTAACAGT
TTTCTCTACGGAATCAGCGGAGGGATCGGCATCGGCTTGCTGACTTTTCT
GGGCACCTCGCGAACCCACCTGTCCACCCACGTGGGCTTCGGCTCCTTCT
TCTGCGGCACCATCGCCTACTGGATGACCTGCAGGTATCAATGGTCCGTC
AGGAGATTCGAGCAGCAGCAATTGCGTGAGGCGATGAGACGACAAGCCCT
TTATGAGGGCACCCAAAGGGAGAGAGACTTAGATCTGAAGTCGGCGGCAA
GCTTTCTAGACC

BO15374.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:35:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7620-PA 333 l(3)87Df-RA 1..330 17..346 1625 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 13:13:51
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 551 CG7620-RA 69..399 16..346 1640 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 13:13:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13031080..13031272 45..237 950 99.5 Plus
3R 32079331 3R 13031331..13031446 231..346 580 100 Plus
Blast to na_te.dros performed on 2015-02-11 13:13:50 has no hits.

BO15374.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:46:23 Download gff for BO15374.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 17..347 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:48:58 Download gff for BO15374.5prime
Subject Subject Range Query Range Percent Splice Strand
CG7620-PA 1..333 17..347 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-25 04:08:36 Download gff for BO15374.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..403 16..352 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:36:05 Download gff for BO15374.5prime
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 69..403 16..352 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 17:36:05 Download gff for BO15374.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 13030981..13031011 16..46 100 -> Plus
3R 13031082..13031269 47..234 99 -> Plus
3R 13031335..13031450 235..352 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-25 04:08:36 Download gff for BO15374.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8856703..8856733 16..46 100 -> Plus
arm_3R 8856804..8856991 47..234 99 -> Plus
arm_3R 8857057..8857172 235..352 97   Plus

BO15374.complete Sequence

364 bp (364 high quality bases) assembled on 2006-06-21

GenBank Submission: FJ633434

> BO15374.complete
GAAGTTATCAGTCGACATGGCCGAAGAACCCGAGGAACCCGCCAAGAGCT
TCGTTATCTTCGGACGCGATGTGGCGCAGATCCCGTGCTTTCGTAACAGT
TTTCTCTACGGAATCAGCGGAGGGATCGGCATCGGCTTGCTGACTTTTCT
GGGCACCTCGCGAACCCACCTGTCCACCCACGTGGGCTTCGGCTCCTTCT
TCTGCGGCACCATCGCCTACTGGATGACCTGCAGGTATCAATGGTCCGTC
AGGAGATTCGAGCAGCAGCAATTGCGTGAGGCGATGAGACGACAAGCCCT
TTATGAGGGCACCCAAAGGGAGAGAGACTTAGATCTGAAGTCGGCGGCAA
GCTTTCTAGACCAT

BO15374.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 333 CG7620-PA 1..330 17..346 1635 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-RA 551 CG7620-RA 69..399 16..346 1640 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:48:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13031080..13031272 45..237 950 99.5 Plus
3R 32079331 3R 13031331..13031446 231..346 580 100 Plus
Blast to na_te.dros performed on 2014-11-28 00:48:08 has no hits.

BO15374.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:39:47 Download gff for BO15374.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 1..333 17..347 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:54:51 Download gff for BO15374.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 40..374 16..352 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:59:49 Download gff for BO15374.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 70..399 17..348 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:39:47 Download gff for BO15374.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 40..374 16..352 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:26:45 Download gff for BO15374.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)87Df-RA 70..399 17..348 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:26:45 Download gff for BO15374.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13030982..13031011 17..46 100 -> Plus
3R 13031082..13031269 47..234 99 -> Plus
3R 13031335..13031446 235..348 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:59:49 Download gff for BO15374.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8856704..8856733 17..46 100 -> Plus
arm_3R 8856804..8856991 47..234 99 -> Plus
arm_3R 8857057..8857168 235..348 98   Plus

BO15374.pep Sequence

Translation from 16 to 364

> BO15374.pep
MAEEPEEPAKSFVIFGRDVAQIPCFRNSFLYGISGGIGIGLLTFLGTSRT
HLSTHVGFGSFFCGTIAYWMTCRYQWSVRRFEQQQLREAMRRQALYEGTQ
RERDLDLKSAASFLDH

BO15374.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 23:53:57
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)87Df-PA 110 CG7620-PA 1..110 1..110 584 100 Plus