Clone Sequence Records
BO15531.3prime Sequence
248 bp (247 high quality bases) assembled on 2006-05-30
> BO15531.3prime
ATGGTCTAGAAAGCTTGCCATAATAACGCATTTGCCCTTTTCGGCCCATG
GATTGTTCTTCTTATCCGGCGCATTGATCAACGGATCATTTTTCTCGTTC
TCCTCGATGAACGAGCGCATTTCTGCTATGGATTTAGATAACGGCCAGCG
CTCCATGGAGGCCTGATATTTCATATTCTCGATTTGCTTCTTTAATGCGT
CCCGATCCATGTTTTGTAGAGCACTGGGATCCATGTCGACTGATAACT
BO15531.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:37:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3694-PA | 219 | Ggamma30A-RA | 1..216 | 234..19 | 1080 | 100 | Minus |
CG3694-PB | 219 | Ggamma30A-RB | 1..216 | 234..19 | 1080 | 100 | Minus |
CG3694-PC | 219 | Ggamma30A-RC | 1..216 | 234..19 | 1080 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:26:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 673..889 | 235..19 | 1085 | 100 | Minus |
Ggamma30A-RH | 4742 | CG3694-RH | 163..379 | 235..19 | 1085 | 100 | Minus |
Ggamma30A-RG | 1470 | CG3694-RG | 614..830 | 235..19 | 1085 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:26:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9272494..9272607 | 235..122 | 570 | 100 | Minus |
2L | 23513712 | 2L | 9291056..9291158 | 121..19 | 515 | 100 | Minus |
Blast to na_te.dros performed 2015-02-10 22:26:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 1173..1235 | 137..73 | 104 | 64.6 | Minus |
BO15531.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:50:15 Download gff for
BO15531.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PB | 1..219 | 15..234 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:54:01 Download gff for
BO15531.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PC | 1..219 | 15..234 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:11:35 Download gff for
BO15531.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 602..837 | 11..248 | 96 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:57:25 Download gff for
BO15531.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 602..837 | 11..248 | 96 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:57:25 Download gff for
BO15531.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9291056..9291165 | 11..121 | 96 | | Minus |
2L | 9272482..9272607 | 122..248 | 96 | -> | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:11:35 Download gff for
BO15531.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9272482..9272607 | 122..248 | 96 | -> | Minus |
arm_2L | 9291056..9291165 | 11..121 | 96 | | Minus |
BO15531.5prime Sequence
248 bp (247 high quality bases) assembled on 2006-05-30
> BO15531.5prime
GAAGTTATCAGTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGGCAAGCTTTCTAGACC
BO15531.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:37:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3694-PA | 219 | Ggamma30A-RA | 1..216 | 17..232 | 1080 | 100 | Plus |
CG3694-PB | 219 | Ggamma30A-RB | 1..216 | 17..232 | 1080 | 100 | Plus |
CG3694-PC | 219 | Ggamma30A-RC | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:47:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 673..889 | 16..232 | 1085 | 100 | Plus |
Ggamma30A-RH | 4742 | CG3694-RH | 163..379 | 16..232 | 1085 | 100 | Plus |
Ggamma30A-RG | 1470 | CG3694-RG | 614..830 | 16..232 | 1085 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:47:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9272494..9272607 | 16..129 | 570 | 100 | Plus |
2L | 23513712 | 2L | 9291056..9291158 | 130..232 | 515 | 100 | Plus |
Blast to na_te.dros performed 2015-02-12 13:47:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 1173..1235 | 114..178 | 104 | 64.6 | Plus |
BO15531.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:50:16 Download gff for
BO15531.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PB | 1..219 | 17..236 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:54:03 Download gff for
BO15531.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3694-PC | 1..219 | 17..236 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 12:36:30 Download gff for
BO15531.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 601..837 | 2..240 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:07:11 Download gff for
BO15531.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 601..837 | 2..240 | 96 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:07:11 Download gff for
BO15531.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9272481..9272607 | 2..129 | 96 | -> | Plus |
2L | 9291056..9291165 | 130..240 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 12:36:30 Download gff for
BO15531.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9272481..9272607 | 2..129 | 96 | -> | Plus |
arm_2L | 9291056..9291165 | 130..240 | 96 | | Plus |
BO15531.complete Sequence
250 bp (250 high quality bases) assembled on 2006-08-24
GenBank Submission: FJ633502
> BO15531.complete
GAAGTTATCAGTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGGCAAGCTTTCTAGACCAT
BO15531.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:35:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 717 | CG3694-PJ | 1..216 | 17..232 | 1080 | 100 | Plus |
Ggamma30A-RH | 219 | CG3694-PH | 1..216 | 17..232 | 1080 | 100 | Plus |
Ggamma30A-RG | 219 | CG3694-PG | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:35:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 673..889 | 16..232 | 1085 | 100 | Plus |
Ggamma30A-RH | 4742 | CG3694-RH | 163..379 | 16..232 | 1085 | 100 | Plus |
Ggamma30A-RG | 1470 | CG3694-RG | 614..830 | 16..232 | 1085 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:35:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9272494..9272607 | 16..129 | 570 | 100 | Plus |
2L | 23513712 | 2L | 9291056..9291158 | 130..232 | 515 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 13:35:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\Tv1 | 6868 | Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). | 1173..1235 | 114..178 | 104 | 64.6 | Plus |
BO15531.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:53:35 Download gff for
BO15531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RC | 1..219 | 17..236 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:53:01 Download gff for
BO15531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RC | 676..891 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:30:54 Download gff for
BO15531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 615..830 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:53:35 Download gff for
BO15531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RC | 662..898 | 2..240 | 96 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:21:55 Download gff for
BO15531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RG | 615..830 | 17..234 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:21:55 Download gff for
BO15531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9272495..9272607 | 17..129 | 100 | -> | Plus |
2L | 9291056..9291158 | 130..234 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:30:54 Download gff for
BO15531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9272495..9272607 | 17..129 | 100 | -> | Plus |
arm_2L | 9291056..9291158 | 130..234 | 98 | | Plus |
BO15531.pep Sequence
Translation from 16 to 250
> BO15531.pep
MDPSALQNMDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKND
PLINAPDKKNNPWAEKGKCVIMASFLDH
BO15531.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:01:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-PH | 72 | CG3694-PH | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PG | 72 | CG3694-PG | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PF | 72 | CG3694-PF | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PC | 72 | CG3694-PC | 1..72 | 1..72 | 381 | 100 | Plus |
Ggamma30A-PB | 72 | CG3694-PB | 1..72 | 1..72 | 381 | 100 | Plus |