Clone BO15531 Report

Search the DGRC for BO15531

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:155
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptGgamma30A-RA
Protein status:BO15531.pep: validated full length
Sequenced Size:250

Clone Sequence Records

BO15531.3prime Sequence

248 bp (247 high quality bases) assembled on 2006-05-30

> BO15531.3prime
ATGGTCTAGAAAGCTTGCCATAATAACGCATTTGCCCTTTTCGGCCCATG
GATTGTTCTTCTTATCCGGCGCATTGATCAACGGATCATTTTTCTCGTTC
TCCTCGATGAACGAGCGCATTTCTGCTATGGATTTAGATAACGGCCAGCG
CTCCATGGAGGCCTGATATTTCATATTCTCGATTTGCTTCTTTAATGCGT
CCCGATCCATGTTTTGTAGAGCACTGGGATCCATGTCGACTGATAACT

BO15531.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG3694-PA 219 Ggamma30A-RA 1..216 234..19 1080 100 Minus
CG3694-PB 219 Ggamma30A-RB 1..216 234..19 1080 100 Minus
CG3694-PC 219 Ggamma30A-RC 1..216 234..19 1080 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 22:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 673..889 235..19 1085 100 Minus
Ggamma30A-RH 4742 CG3694-RH 163..379 235..19 1085 100 Minus
Ggamma30A-RG 1470 CG3694-RG 614..830 235..19 1085 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 22:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9272494..9272607 235..122 570 100 Minus
2L 23513712 2L 9291056..9291158 121..19 515 100 Minus
Blast to na_te.dros performed 2015-02-10 22:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1173..1235 137..73 104 64.6 Minus

BO15531.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:50:15 Download gff for BO15531.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PB 1..219 15..234 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:54:01 Download gff for BO15531.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PC 1..219 15..234 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-21 18:11:35 Download gff for BO15531.3prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 602..837 11..248 96   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:57:25 Download gff for BO15531.3prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 602..837 11..248 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:57:25 Download gff for BO15531.3prime
Subject Subject Range Query Range Percent Splice Strand
2L 9291056..9291165 11..121 96   Minus
2L 9272482..9272607 122..248 96 -> Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-21 18:11:35 Download gff for BO15531.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9272482..9272607 122..248 96 -> Minus
arm_2L 9291056..9291165 11..121 96   Minus

BO15531.5prime Sequence

248 bp (247 high quality bases) assembled on 2006-05-30

> BO15531.5prime
GAAGTTATCAGTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGGCAAGCTTTCTAGACC

BO15531.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG3694-PA 219 Ggamma30A-RA 1..216 17..232 1080 100 Plus
CG3694-PB 219 Ggamma30A-RB 1..216 17..232 1080 100 Plus
CG3694-PC 219 Ggamma30A-RC 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 673..889 16..232 1085 100 Plus
Ggamma30A-RH 4742 CG3694-RH 163..379 16..232 1085 100 Plus
Ggamma30A-RG 1470 CG3694-RG 614..830 16..232 1085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9272494..9272607 16..129 570 100 Plus
2L 23513712 2L 9291056..9291158 130..232 515 100 Plus
Blast to na_te.dros performed 2015-02-12 13:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1173..1235 114..178 104 64.6 Plus

BO15531.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:50:16 Download gff for BO15531.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PB 1..219 17..236 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:54:03 Download gff for BO15531.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3694-PC 1..219 17..236 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 12:36:30 Download gff for BO15531.5prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 601..837 2..240 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:07:11 Download gff for BO15531.5prime
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 601..837 2..240 96   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:07:11 Download gff for BO15531.5prime
Subject Subject Range Query Range Percent Splice Strand
2L 9272481..9272607 2..129 96 -> Plus
2L 9291056..9291165 130..240 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 12:36:30 Download gff for BO15531.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9272481..9272607 2..129 96 -> Plus
arm_2L 9291056..9291165 130..240 96   Plus

BO15531.complete Sequence

250 bp (250 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633502

> BO15531.complete
GAAGTTATCAGTCGACATGGATCCCAGTGCTCTACAAAACATGGATCGGG
ACGCATTAAAGAAGCAAATCGAGAATATGAAATATCAGGCCTCCATGGAG
CGCTGGCCGTTATCTAAATCCATAGCAGAAATGCGCTCGTTCATCGAGGA
GAACGAGAAAAATGATCCGTTGATCAATGCGCCGGATAAGAAGAACAATC
CATGGGCCGAAAAGGGCAAATGCGTTATTATGGCAAGCTTTCTAGACCAT

BO15531.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 717 CG3694-PJ 1..216 17..232 1080 100 Plus
Ggamma30A-RH 219 CG3694-PH 1..216 17..232 1080 100 Plus
Ggamma30A-RG 219 CG3694-PG 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 673..889 16..232 1085 100 Plus
Ggamma30A-RH 4742 CG3694-RH 163..379 16..232 1085 100 Plus
Ggamma30A-RG 1470 CG3694-RG 614..830 16..232 1085 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9272494..9272607 16..129 570 100 Plus
2L 23513712 2L 9291056..9291158 130..232 515 100 Plus
Blast to na_te.dros performed 2014-11-27 13:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Tv1 6868 Dvir\Tv1 6868bp Derived from AF056940 (Rel. 62, Last updated, Version 4). 1173..1235 114..178 104 64.6 Plus

BO15531.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:53:35 Download gff for BO15531.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RC 1..219 17..236 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:53:01 Download gff for BO15531.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RC 676..891 17..234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:30:54 Download gff for BO15531.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 615..830 17..234 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:53:35 Download gff for BO15531.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RC 662..898 2..240 96   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:21:55 Download gff for BO15531.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RG 615..830 17..234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:21:55 Download gff for BO15531.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9272495..9272607 17..129 100 -> Plus
2L 9291056..9291158 130..234 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:30:54 Download gff for BO15531.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9272495..9272607 17..129 100 -> Plus
arm_2L 9291056..9291158 130..234 98   Plus

BO15531.pep Sequence

Translation from 16 to 250

> BO15531.pep
MDPSALQNMDRDALKKQIENMKYQASMERWPLSKSIAEMRSFIEENEKND
PLINAPDKKNNPWAEKGKCVIMASFLDH

BO15531.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:01:04
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-PH 72 CG3694-PH 1..72 1..72 381 100 Plus
Ggamma30A-PG 72 CG3694-PG 1..72 1..72 381 100 Plus
Ggamma30A-PF 72 CG3694-PF 1..72 1..72 381 100 Plus
Ggamma30A-PC 72 CG3694-PC 1..72 1..72 381 100 Plus
Ggamma30A-PB 72 CG3694-PB 1..72 1..72 381 100 Plus