Clone BO15640 Report

Search the DGRC for BO15640

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:156
Well:40
Vector:pDNR-Dual
Associated Gene/Transcriptave-RA
Protein status:BO15640.pep: validated full length
Sequenced Size:352

Clone Sequence Records

BO15640.3prime Sequence

350 bp (350 high quality bases) assembled on 2006-06-02

> BO15640.3prime
ATGGTCTAGAAAGCTTGCGTAAATATTGAGCCTTTCCATATCCCGGATTT
CCATGATATCCGTCTTCAGTCGCTGCTTAACGATCTCCCGCCAAATGGCT
TCCCGATCCCGGTTGTCCGTCACGCCCATTCTTTGCAGTGAGGAGTCTGT
GATCCGGAGTAGAGCCCTTCCGGTTATATCGTGCTGGGCGAAGAGCTGCT
CATACTGGGTGTATTCACCGCAGTGGCGGCGATACCACTTGAGCACATCG
CTAACTGTCCACAGGTACACTGCCTTCGGTCGCGTAGTTTTCGTTCTGGT
TTTGTTTTGCGTTGAGTTAATAGTTTCTTCACCCATGTCGACTGATAACT

BO15640.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30476-PA 321 CG30476-RA 1..318 336..19 1590 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 18:25:51
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 546 CG30476-RA 70..387 336..19 1590 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 18:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14752943..14753110 186..19 840 100 Minus
2R 25286936 2R 14752590..14752742 336..184 765 100 Minus
Blast to na_te.dros performed on 2015-02-10 18:25:51 has no hits.

BO15640.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:52:20 Download gff for BO15640.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30476-PA 1..321 18..336 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:56:50 Download gff for BO15640.3prime
Subject Subject Range Query Range Percent Splice Strand
CG30476-PA 1..321 18..336 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-20 14:48:02 Download gff for BO15640.3prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 58..387 19..349 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 19:51:44 Download gff for BO15640.3prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 58..387 19..349 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 19:51:44 Download gff for BO15640.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 14752578..14752742 184..349 96 -> Minus
2R 14752946..14753110 19..183 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-20 14:48:02 Download gff for BO15640.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10640083..10640247 184..349 96 -> Minus
arm_2R 10640451..10640615 19..183 100   Minus

BO15640.5prime Sequence

350 bp (350 high quality bases) assembled on 2006-05-30

> BO15640.5prime
GAAGTTATCAGTCGACATGGGTGAAGAAACTATTAACTCAACGCAAAACA
AAACCAGAACGAAAACTACGCGACCGAAGGCAGTGTACCTGTGGACAGTT
AGCGATGTGCTCAAGTGGTATCGCCGCCACTGCGGTGAATACACCCAGTA
TGAGCAGCTCTTCGCCCAGCACGATATAACCGGAAGGGCTCTACTCCGGA
TCACAGACTCCTCACTGCAAAGAATGGGCGTGACGGACAACCGGGATCGG
GAAGCCATTTGGCGGGAGATCGTTAAGCAGCGACTGAAGACGGATATCAT
GGAAATCCGGGATATGGAAAGGCTCAATATTTACGCAAGCTTTCTAGACC

BO15640.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG30476-PA 321 CG30476-RA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 10:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 546 CG30476-RA 70..387 17..334 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 10:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14752943..14753110 167..334 840 100 Plus
2R 25286936 2R 14752590..14752742 17..169 765 100 Plus
Blast to na_te.dros performed on 2015-02-09 10:50:51 has no hits.

BO15640.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:52:21 Download gff for BO15640.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30476-PA 1..321 17..335 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:56:52 Download gff for BO15640.5prime
Subject Subject Range Query Range Percent Splice Strand
CG30476-PA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-12 16:38:17 Download gff for BO15640.5prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 58..387 4..334 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-09 11:40:06 Download gff for BO15640.5prime
Subject Subject Range Query Range Percent Splice Strand
ave-RA 58..387 4..334 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-09 11:40:06 Download gff for BO15640.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 14752578..14752742 4..169 96 -> Plus
2R 14752946..14753110 170..334 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-12 16:38:17 Download gff for BO15640.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10640083..10640247 4..169 96 -> Plus
arm_2R 10640451..10640615 170..334 100   Plus

BO15640.complete Sequence

352 bp (352 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633527

> BO15640.complete
GAAGTTATCAGTCGACATGGGTGAAGAAACTATTAACTCAACGCAAAACA
AAACCAGAACGAAAACTACGCGACCGAAGGCAGTGTACCTGTGGACAGTT
AGCGATGTGCTCAAGTGGTATCGCCGCCACTGCGGTGAATACACCCAGTA
TGAGCAGCTCTTCGCCCAGCACGATATAACCGGAAGGGCTCTACTCCGGA
TCACAGACTCCTCACTGCAAAGAATGGGCGTGACGGACAACCGGGATCGG
GAAGCCATTTGGCGGGAGATCGTTAAGCAGCGACTGAAGACGGATATCAT
GGAAATCCGGGATATGGAAAGGCTCAATATTTACGCAAGCTTTCTAGACC
AT

BO15640.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:33:01
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 321 CG30476-PA 1..318 17..334 1590 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:33:03
Subject Length Description Subject Range Query Range Score Percent Strand
ave-RA 546 CG30476-RA 70..387 17..334 1590 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:32:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14752943..14753110 167..334 840 100 Plus
2R 25286936 2R 14752590..14752742 17..169 765 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:33:00 has no hits.

BO15640.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:53:05 Download gff for BO15640.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 1..321 17..335 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:09:04 Download gff for BO15640.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 53..382 4..334 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:51 Download gff for BO15640.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 70..387 17..336 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:53:06 Download gff for BO15640.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 53..382 4..334 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:47 Download gff for BO15640.complete
Subject Subject Range Query Range Percent Splice Strand
ave-RA 70..387 17..336 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:24:47 Download gff for BO15640.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14752590..14752742 17..169 100 -> Plus
2R 14752946..14753110 170..336 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:51 Download gff for BO15640.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10640095..10640247 17..169 100 -> Plus
arm_2R 10640451..10640615 170..336 98   Plus

BO15640.pep Sequence

Translation from 16 to 352

> BO15640.pep
MGEETINSTQNKTRTKTTRPKAVYLWTVSDVLKWYRRHCGEYTQYEQLFA
QHDITGRALLRITDSSLQRMGVTDNRDREAIWREIVKQRLKTDIMEIRDM
ERLNIYASFLDH

BO15640.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
ave-PA 106 CG30476-PA 1..106 1..106 557 100 Plus