Clone Sequence Records
BO15662.5prime Sequence
350 bp (350 high quality bases) assembled on 2006-05-30
> BO15662.5prime
GAAGTTATCAGTCGACATGCTGTCGCAATCCCTGCTGAGTGGCATGCGTG
TCCTGCGCACAGAGGCCCGTCGTAACTTCGGAATCGTTGCCCCTGCCCTG
AACAAGGCCTCCGATCCCATCCAGCAGCTGTTCCTGGACAAAGTGCGCGA
GTACAAGCAGAAGAGCGCCGGTGGCAAGCTGGTGGACTCCAATCCCGATA
TTGAGCGGGAGCTGAAGACCGAACTGGACCGTGTGGCCAAGCAGTTTGGC
AGCGATGGCAAGACCGACATGCTGAAGTTCCCCGAATTCCAGTTCCCCGA
TGTTAAGGTCGATCCCATCACCCAGGCCCCACAGGCAAGCTTTCTAGACC
BO15662.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4412-PA | 321 | ATPsyn-Cf6-RA | 1..318 | 17..334 | 1590 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:45:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ATPsyn-Cf6-RB | 616 | CG4412-RB | 150..467 | 17..334 | 1590 | 100 | Plus |
ATPsyn-Cf6-RC | 586 | CG4412-RC | 85..402 | 17..334 | 1590 | 100 | Plus |
ATPsyn-Cf6-RA | 526 | CG4412-RA | 85..402 | 17..334 | 1590 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:45:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23355404..23355569 | 334..169 | 830 | 100 | Minus |
3R | 32079331 | 3R | 23355634..23355785 | 168..17 | 760 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 21:45:32 has no hits.
BO15662.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:52:36 Download gff for
BO15662.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4412-PA | 1..321 | 17..335 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:57:11 Download gff for
BO15662.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4412-PA | 1..321 | 17..335 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 00:50:09 Download gff for
BO15662.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 85..402 | 17..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:50:12 Download gff for
BO15662.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 85..402 | 17..334 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:50:12 Download gff for
BO15662.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23355404..23355569 | 169..334 | 100 | <- | Minus |
3R | 23355634..23355797 | 6..168 | 97 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 00:50:09 Download gff for
BO15662.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19181126..19181291 | 169..334 | 100 | <- | Minus |
arm_3R | 19181356..19181519 | 6..168 | 97 | | Minus |
BO15662.3prime Sequence
350 bp (350 high quality bases) assembled on 2006-05-30
> BO15662.3prime
ATGGTCTAGAAAGCTTGCCTGTGGGGCCTGGGTGATGGGATCGACCTTAA
CATCGGGGAACTGGAATTCGGGGAACTTCAGCATGTCGGTCTTGCCATCG
CTGCCAAACTGCTTGGCCACACGGTCCAGTTCGGTCTTCAGCTCCCGCTC
AATATCGGGATTGGAGTCCACCAGCTTGCCACCGGCGCTCTTCTGCTTGT
ACTCGCGCACTTTGTCCAGGAACAGCTGCTGGATGGGATCGGAGGCCTTG
TTCAGGGCAGGGGCAACGATTCCGAAGTTACGACGGGCCTCTGTGCGCAG
GACACGCATGCCACTCAGCAGGGATTGCGACAGCATGTCGACTGATAACT
BO15662.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG4412-PA | 321 | ATPsyn-Cf6-RA | 1..318 | 336..19 | 1590 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-11 17:58:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ATPsyn-Cf6-RB | 616 | CG4412-RB | 150..467 | 336..19 | 1590 | 100 | Minus |
ATPsyn-Cf6-RC | 586 | CG4412-RC | 85..402 | 336..19 | 1590 | 100 | Minus |
ATPsyn-Cf6-RA | 526 | CG4412-RA | 85..402 | 336..19 | 1590 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-11 17:58:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23355404..23355569 | 19..184 | 830 | 100 | Plus |
3R | 32079331 | 3R | 23355634..23355785 | 185..336 | 760 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-11 17:58:40 has no hits.
BO15662.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:52:35 Download gff for
BO15662.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4412-PA | 1..321 | 18..336 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:57:10 Download gff for
BO15662.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG4412-PA | 1..321 | 18..336 | 99 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-26 10:27:42 Download gff for
BO15662.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 85..402 | 19..336 | 100 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-11 19:34:21 Download gff for
BO15662.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 85..402 | 19..336 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-11 19:34:21 Download gff for
BO15662.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23355404..23355569 | 19..184 | 100 | <- | Plus |
3R | 23355634..23355797 | 185..347 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-26 10:27:42 Download gff for
BO15662.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19181126..19181291 | 19..184 | 100 | <- | Plus |
arm_3R | 19181356..19181519 | 185..347 | 97 | | Plus |
BO15662.complete Sequence
352 bp (352 high quality bases) assembled on 2006-08-24
GenBank Submission: FJ633539
> BO15662.complete
GAAGTTATCAGTCGACATGCTGTCGCAATCCCTGCTGAGTGGCATGCGTG
TCCTGCGCACAGAGGCCCGTCGTAACTTCGGAATCGTTGCCCCTGCCCTG
AACAAGGCCTCCGATCCCATCCAGCAGCTGTTCCTGGACAAAGTGCGCGA
GTACAAGCAGAAGAGCGCCGGTGGCAAGCTGGTGGACTCCAATCCCGATA
TTGAGCGGGAGCTGAAGACCGAACTGGACCGTGTGGCCAAGCAGTTTGGC
AGCGATGGCAAGACCGACATGCTGAAGTTCCCCGAATTCCAGTTCCCCGA
TGTTAAGGTCGATCCCATCACCCAGGCCCCACAGGCAAGCTTTCTAGACC
AT
BO15662.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:54:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ATPsyn-Cf6-RB | 321 | CG4412-PB | 1..318 | 17..334 | 1590 | 100 | Plus |
ATPsyn-Cf6-RC | 321 | CG4412-PC | 1..318 | 17..334 | 1590 | 100 | Plus |
ATPsyn-Cf6-RA | 321 | CG4412-PA | 1..318 | 17..334 | 1590 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:54:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ATPsyn-Cf6-RB | 616 | CG4412-RB | 150..467 | 17..334 | 1590 | 100 | Plus |
ATPsyn-Cf6-RC | 586 | CG4412-RC | 85..402 | 17..334 | 1590 | 100 | Plus |
ATPsyn-Cf6-RA | 526 | CG4412-RA | 85..402 | 17..334 | 1590 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:54:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23355404..23355569 | 334..169 | 830 | 100 | Minus |
3R | 32079331 | 3R | 23355634..23355785 | 168..17 | 760 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:54:48 has no hits.
BO15662.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:52:59 Download gff for
BO15662.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 1..321 | 17..335 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 06:08:55 Download gff for
BO15662.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 81..398 | 17..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:02:14 Download gff for
BO15662.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 85..402 | 17..336 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:53:00 Download gff for
BO15662.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 81..398 | 17..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:28:51 Download gff for
BO15662.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
ATPsyn-Cf6-RA | 85..402 | 17..336 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:28:51 Download gff for
BO15662.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23355402..23355569 | 169..336 | 98 | <- | Minus |
3R | 23355634..23355785 | 17..168 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:02:14 Download gff for
BO15662.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19181124..19181291 | 169..336 | 98 | <- | Minus |
arm_3R | 19181356..19181507 | 17..168 | 100 | | Minus |
BO15662.pep Sequence
Translation from 16 to 352
> BO15662.pep
MLSQSLLSGMRVLRTEARRNFGIVAPALNKASDPIQQLFLDKVREYKQKS
AGGKLVDSNPDIERELKTELDRVAKQFGSDGKTDMLKFPEFQFPDVKVDP
ITQAPQASFLDH
BO15662.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 19:50:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ATPsyn-Cf6-PB | 106 | CG4412-PB | 1..106 | 1..106 | 534 | 100 | Plus |
ATPsyn-Cf6-PC | 106 | CG4412-PC | 1..106 | 1..106 | 534 | 100 | Plus |
ATPsyn-Cf6-PA | 106 | CG4412-PA | 1..106 | 1..106 | 534 | 100 | Plus |
CG12027-PA | 147 | CG12027-PA | 26..95 | 33..102 | 203 | 54.3 | Plus |