Clone BO15696 Report

Search the DGRC for BO15696

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:156
Well:96
Vector:pDNR-Dual
Associated Gene/TranscriptRpL39-RA
Protein status:BO15696.pep:
Sequenced Size:187

Clone Sequence Records

BO15696.5prime Sequence

185 bp (185 high quality bases) assembled on 2006-05-30

> BO15696.5prime
GAAGTTATCAGTCGACATGGCTGCACACAAGTCGTTCAGAATAAAGCAGA
AGCTGGCTAAGAAGCTGAAGCAGAACAGATCCGTTCCCCAATGGGTTCGC
CTACGTACTGGCAACACTATTCGTTACAACGCTAAGCGCCGTCACTGGAG
GCGTACCAAGTTGAAGCTGGCAAGCTTTCTAGACC

BO15696.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG3997-PA 156 RpL39-RA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-RA 288 CG3997-RA 38..194 13..169 770 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24062198..24062302 123..19 525 100 Minus
2R 25286936 2R 24061947..24061993 169..123 235 100 Minus
Blast to na_te.dros performed on 2015-02-10 21:44:33 has no hits.

BO15696.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 06:53:11 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:57:57 Download gff for BO15696.5prime
Subject Subject Range Query Range Percent Splice Strand
CG3997-PA 1..156 17..173 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 00:49:56 Download gff for BO15696.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 32..205 7..183 94   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:50:01 Download gff for BO15696.5prime
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 32..205 7..183 94   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:50:01 Download gff for BO15696.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 24061936..24061992 124..183 91 <- Minus
2R 24062198..24062311 8..123 95   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 00:49:56 Download gff for BO15696.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19949459..19949515 124..183 91 <- Minus
arm_2R 19949721..19949834 8..123 95   Minus

BO15696.3prime Sequence

185 bp (185 high quality bases) assembled on 2006-06-02

> BO15696.3prime
ATGGTCTAGAAAGCTTGCCAGCTTCAACTTGGTACGCCTCCAGTGACGGC
GCTTAGCGTTGTAACGAATAGTGTTGCCAGTACGTAGGCGAACCCATTGG
GGAACGGATCTGTTCTGCTTCAGCTTCTTAGCCAGCTTCTGCTTTATTCT
GAACGACTTGTGTGCAGCCATGTCGACTGATAACT

BO15696.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG3997-PA 156 RpL39-RA 1..153 171..19 765 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-RA 288 CG3997-RA 38..194 175..19 770 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24062198..24062302 65..169 525 100 Plus
2R 25286936 2R 24061947..24061993 19..65 235 100 Plus
Blast to na_te.dros performed on 2015-02-12 13:45:50 has no hits.

BO15696.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 06:53:10 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:57:55 Download gff for BO15696.3prime
Subject Subject Range Query Range Percent Splice Strand
CG3997-PA 1..156 15..171 98   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 12:35:57 Download gff for BO15696.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 32..205 5..181 94   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:01:59 Download gff for BO15696.3prime
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 32..205 5..181 94   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:01:59 Download gff for BO15696.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 24061936..24061992 5..64 91 <- Plus
2R 24062198..24062311 65..180 95   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 12:35:57 Download gff for BO15696.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19949459..19949515 5..64 91 <- Plus
arm_2R 19949721..19949834 65..180 95   Plus

BO15696.complete Sequence

187 bp assembled on 2007-12-19

GenBank Submission: FJ633556

> BO15696.complete
GAAGTTATCAGTCGACATGGCTGCACACAAGTCGTTCAGAATAAAGCAGA
AGCTGGCTAAGAAGCTGAAGCAGAACAGATCCGTTCCCCAATGGGTTCGC
CTACGTACTGGCAACACTATTCGTTACAACGCTAAGCGCCGTCACTGGAG
GCGTACCAAGTTGAAGCTGGCAAGCTTTCTAGACCAT

BO15696.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:17:04
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-RA 156 CG3997-PA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:17:05
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-RA 288 CG3997-RA 38..194 13..169 770 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:17:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24062198..24062302 123..19 525 100 Minus
2R 25286936 2R 24061947..24061993 169..123 235 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:17:02 has no hits.

BO15696.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:02:56 Download gff for BO15696.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 1..156 17..173 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:35:32 Download gff for BO15696.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 40..192 17..171 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:39:16 Download gff for BO15696.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 42..194 17..171 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:02:57 Download gff for BO15696.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 30..203 7..183 94   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:04:08 Download gff for BO15696.complete
Subject Subject Range Query Range Percent Splice Strand
RpL39-RA 42..194 17..171 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:04:08 Download gff for BO15696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24062198..24062303 17..123 99   Minus
2R 24061945..24061992 124..171 95 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:39:16 Download gff for BO15696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19949468..19949515 124..171 95 <- Minus
arm_2R 19949721..19949826 17..123 99   Minus

BO15696.pep Sequence

Translation from 16 to 187

> BO15696.pep
MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLK
LASFLDH

BO15696.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
RpL39-PA 51 CG3997-PA 1..51 1..51 267 100 Plus