Clone Sequence Records
BO15696.5prime Sequence
185 bp (185 high quality bases) assembled on 2006-05-30
> BO15696.5prime
GAAGTTATCAGTCGACATGGCTGCACACAAGTCGTTCAGAATAAAGCAGA
AGCTGGCTAAGAAGCTGAAGCAGAACAGATCCGTTCCCCAATGGGTTCGC
CTACGTACTGGCAACACTATTCGTTACAACGCTAAGCGCCGTCACTGGAG
GCGTACCAAGTTGAAGCTGGCAAGCTTTCTAGACC
BO15696.5prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3997-PA | 156 | RpL39-RA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-10 21:44:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL39-RA | 288 | CG3997-RA | 38..194 | 13..169 | 770 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-10 21:44:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24062198..24062302 | 123..19 | 525 | 100 | Minus |
2R | 25286936 | 2R | 24061947..24061993 | 169..123 | 235 | 100 | Minus |
Blast to na_te.dros performed on 2015-02-10 21:44:33 has no hits.
BO15696.5prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 06:53:11 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:57:57 Download gff for
BO15696.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3997-PA | 1..156 | 17..173 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-22 00:49:56 Download gff for
BO15696.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 32..205 | 7..183 | 94 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 23:50:01 Download gff for
BO15696.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 32..205 | 7..183 | 94 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 23:50:01 Download gff for
BO15696.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24061936..24061992 | 124..183 | 91 | <- | Minus |
2R | 24062198..24062311 | 8..123 | 95 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-22 00:49:56 Download gff for
BO15696.5prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19949459..19949515 | 124..183 | 91 | <- | Minus |
arm_2R | 19949721..19949834 | 8..123 | 95 | | Minus |
BO15696.3prime Sequence
185 bp (185 high quality bases) assembled on 2006-06-02
> BO15696.3prime
ATGGTCTAGAAAGCTTGCCAGCTTCAACTTGGTACGCCTCCAGTGACGGC
GCTTAGCGTTGTAACGAATAGTGTTGCCAGTACGTAGGCGAACCCATTGG
GGAACGGATCTGTTCTGCTTCAGCTTCTTAGCCAGCTTCTGCTTTATTCT
GAACGACTTGTGTGCAGCCATGTCGACTGATAACT
BO15696.3prime Blast Records
Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:39:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG3997-PA | 156 | RpL39-RA | 1..153 | 171..19 | 765 | 100 | Minus |
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 13:45:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL39-RA | 288 | CG3997-RA | 38..194 | 175..19 | 770 | 99.4 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 13:45:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24062198..24062302 | 65..169 | 525 | 100 | Plus |
2R | 25286936 | 2R | 24061947..24061993 | 19..65 | 235 | 100 | Plus |
Blast to na_te.dros performed on 2015-02-12 13:45:50 has no hits.
BO15696.3prime Sim4 Records
Sim4 to dmel-all-CDS-r4.3.fasta performed on 2007-01-18 06:53:10 has no hits.
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:57:55 Download gff for
BO15696.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG3997-PA | 1..156 | 15..171 | 98 | | Minus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-30 12:35:57 Download gff for
BO15696.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 32..205 | 5..181 | 94 | | Minus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-12 18:01:59 Download gff for
BO15696.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 32..205 | 5..181 | 94 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-12 18:01:59 Download gff for
BO15696.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24061936..24061992 | 5..64 | 91 | <- | Plus |
2R | 24062198..24062311 | 65..180 | 95 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-30 12:35:57 Download gff for
BO15696.3prime
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19949459..19949515 | 5..64 | 91 | <- | Plus |
arm_2R | 19949721..19949834 | 65..180 | 95 | | Plus |
BO15696.complete Sequence
187 bp assembled on 2007-12-19
GenBank Submission: FJ633556
> BO15696.complete
GAAGTTATCAGTCGACATGGCTGCACACAAGTCGTTCAGAATAAAGCAGA
AGCTGGCTAAGAAGCTGAAGCAGAACAGATCCGTTCCCCAATGGGTTCGC
CTACGTACTGGCAACACTATTCGTTACAACGCTAAGCGCCGTCACTGGAG
GCGTACCAAGTTGAAGCTGGCAAGCTTTCTAGACCAT
BO15696.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:17:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL39-RA | 156 | CG3997-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:17:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL39-RA | 288 | CG3997-RA | 38..194 | 13..169 | 770 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:17:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 24062198..24062302 | 123..19 | 525 | 100 | Minus |
2R | 25286936 | 2R | 24061947..24061993 | 169..123 | 235 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:17:02 has no hits.
BO15696.complete Sim4 Records
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:02:56 Download gff for
BO15696.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 1..156 | 17..173 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-28 15:35:32 Download gff for
BO15696.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 40..192 | 17..171 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:39:16 Download gff for
BO15696.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 42..194 | 17..171 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 14:02:57 Download gff for
BO15696.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 30..203 | 7..183 | 94 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:04:08 Download gff for
BO15696.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL39-RA | 42..194 | 17..171 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:04:08 Download gff for
BO15696.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 24062198..24062303 | 17..123 | 99 | | Minus |
2R | 24061945..24061992 | 124..171 | 95 | <- | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:39:16 Download gff for
BO15696.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 19949468..19949515 | 124..171 | 95 | <- | Minus |
arm_2R | 19949721..19949826 | 17..123 | 99 | | Minus |
BO15696.pep Sequence
Translation from 16 to 187
> BO15696.pep
MAAHKSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLK
LASFLDH
BO15696.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 02:39:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL39-PA | 51 | CG3997-PA | 1..51 | 1..51 | 267 | 100 | Plus |