Clone BO15778 Report

Search the DGRC for BO15778

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:157
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG6783-RA
Protein status:BO15778.pep: validated full length
Sequenced Size:385

Clone Sequence Records

BO15778.5prime Sequence

383 bp (383 high quality bases) assembled on 2006-05-30

> BO15778.5prime
GAAGTTATCAGTCGACATGTGCAGTCTGCCCCATCATTCATCTTTCGGCG
TCGGTCTGGTGACGCGCAAGATGGGCAACAGCCTGAGCCCCACAGTGGAG
GTGACCTTGGAGGGCGATACCTACACCCTGACTACCACCTCCACCTTCAA
GACCTCTGCCATCAGCTTCAAGCTGGGCGTTGAGTTCGACGAGGAGACCC
TGGACGGTCGCAACGTCAAGAGCATCATCACCCTGGATGGCAACAAGCTG
ACGCAGGAGCAGAAGGGCGACAAGCCCACCACCATCGTCCGCGAGTTCAC
CGACAACGAGCTGATCACCACCCTCACCATCGGCAACGTTAAGTGCGTGC
GCGTCTACAAGGCCGTCGCAAGCTTTCTAGACC

BO15778.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6783-PA 354 CG6783-RA 1..351 17..367 1755 100 Plus
CG6783-PB 393 CG6783-RB 70..390 47..367 1605 100 Plus
CG6783-PC 474 CG6783-RC 70..342 47..319 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-09 22:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 1051 CG6783-RA 435..785 17..367 1755 100 Plus
fabp-RB 723 CG6783-RB 137..457 47..367 1605 100 Plus
fabp-RC 1660 CG6783-RC 137..409 47..319 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-09 22:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564440..11564712 319..47 1365 100 Minus
3R 32079331 3R 11564324..11564371 367..320 240 100 Minus
Blast to na_te.dros performed on 2015-02-09 22:29:57 has no hits.

BO15778.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:54:07 Download gff for BO15778.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6783-PA 1..354 17..371 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:59:08 Download gff for BO15778.5prime
Subject Subject Range Query Range Percent Splice Strand
CG6783-PA 1..354 17..371 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-13 08:20:59 Download gff for BO15778.5prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 424..784 12..372 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-10 00:45:13 Download gff for BO15778.5prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 429..789 12..372 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-10 00:45:13 Download gff for BO15778.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 11564320..11564371 320..372 96 <- Minus
3R 11564440..11564711 48..319 100 <- Minus
3R 11564784..11564820 12..47 91   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-13 08:20:59 Download gff for BO15778.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7390042..7390093 320..372 96 <- Minus
arm_3R 7390162..7390433 48..319 100 <- Minus
arm_3R 7390506..7390542 12..47 91   Minus

BO15778.3prime Sequence

383 bp (383 high quality bases) assembled on 2006-05-30

> BO15778.3prime
ATGGTCTAGAAAGCTTGCGACGGCCTTGTAGACGCGCACGCACTTAACGT
TGCCGATGGTGAGGGTGGTGATCAGCTCGTTGTCGGTGAACTCGCGGACG
ATGGTGGTGGGCTTGTCGCCCTTCTGCTCCTGCGTCAGCTTGTTGCCATC
CAGGGTGATGATGCTCTTGACGTTGCGACCGTCCAGGGTCTCCTCGTCGA
ACTCAACGCCCAGCTTGAAGCTGATGGCAGAGGTCTTGAAGGTGGAGGTG
GTAGTCAGGGTGTAGGTATCGCCCTCCAAGGTCACCTCCACTGTGGGGCT
CAGGCTGTTGCCCATCTTGCGCGTCACCAGACCGACGCCGAAAGATGAAT
GATGGGGCAGACTGCACATGTCGACTGATAACT

BO15778.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:40:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG6783-PA 354 CG6783-RA 1..351 369..19 1755 100 Minus
CG6783-PB 393 CG6783-RB 70..390 339..19 1605 100 Minus
CG6783-PC 474 CG6783-RC 70..342 339..67 1365 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-01-30 18:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 1051 CG6783-RA 435..785 369..19 1755 100 Minus
fabp-RB 723 CG6783-RB 137..457 339..19 1605 100 Minus
fabp-RC 1660 CG6783-RC 137..409 339..67 1365 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-01-30 18:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564440..11564712 67..339 1365 100 Plus
3R 32079331 3R 11564324..11564371 19..66 240 100 Plus
Blast to na_te.dros performed on 2015-01-30 18:28:16 has no hits.

BO15778.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:54:06 Download gff for BO15778.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6783-PA 1..354 15..369 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 06:59:06 Download gff for BO15778.3prime
Subject Subject Range Query Range Percent Splice Strand
CG6783-PA 1..354 15..369 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-06 18:58:31 Download gff for BO15778.3prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 424..784 14..374 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-01-30 20:11:55 Download gff for BO15778.3prime
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 429..789 14..374 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-01-30 20:11:55 Download gff for BO15778.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 11564320..11564371 14..66 96 <- Plus
3R 11564440..11564711 67..338 100 <- Plus
3R 11564784..11564820 339..374 91   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-06 18:58:31 Download gff for BO15778.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7390042..7390093 14..66 96 <- Plus
arm_3R 7390162..7390433 67..338 100 <- Plus
arm_3R 7390506..7390542 339..374 91   Plus

BO15778.complete Sequence

385 bp (385 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633580

> BO15778.complete
GAAGTTATCAGTCGACATGTGCAGTCTGCCCCATCATTCATCTTTCGGCG
TCGGTCTGGTGACGCGCAAGATGGGCAACAGCCTGAGCCCCACAGTGGAG
GTGACCTTGGAGGGCGATACCTACACCCTGACTACCACCTCCACCTTCAA
GACCTCTGCCATCAGCTTCAAGCTGGGCGTTGAGTTCGACGAGGAGACCC
TGGACGGTCGCAACGTCAAGAGCATCATCACCCTGGATGGCAACAAGCTG
ACGCAGGAGCAGAAGGGCGACAAGCCCACCACCATCGTCCGCGAGTTCAC
CGACAACGAGCTGATCACCACCCTCACCATCGGCAACGTTAAGTGCGTGC
GCGTCTACAAGGCCGTCGCAAGCTTTCTAGACCAT

BO15778.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 354 CG6783-PA 1..351 17..367 1755 100 Plus
fabp-RB 393 CG6783-PB 70..390 47..367 1605 100 Plus
fabp-RC 474 CG6783-PC 70..342 47..319 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-RA 1051 CG6783-RA 435..785 17..367 1755 100 Plus
fabp-RB 723 CG6783-RB 137..457 47..367 1605 100 Plus
fabp-RC 1660 CG6783-RC 137..409 47..319 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:21:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11564440..11564712 319..47 1365 100 Minus
3R 32079331 3R 11564324..11564371 367..320 240 100 Minus
Blast to na_te.dros performed on 2014-11-27 20:21:03 has no hits.

BO15778.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:26:04 Download gff for BO15778.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 1..354 17..371 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 05:54:50 Download gff for BO15778.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 424..784 12..372 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:06:47 Download gff for BO15778.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 430..780 17..369 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:26:04 Download gff for BO15778.complete
Subject Subject Range Query Range Percent Splice Strand
CG6783-RA 424..784 12..372 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:19:51 Download gff for BO15778.complete
Subject Subject Range Query Range Percent Splice Strand
fabp-RA 435..785 17..369 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:19:51 Download gff for BO15778.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11564322..11564371 320..369 96 <- Minus
3R 11564440..11564711 48..319 100 <- Minus
3R 11564784..11564814 17..47 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:06:47 Download gff for BO15778.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7390044..7390093 320..369 96 <- Minus
arm_3R 7390162..7390433 48..319 100 <- Minus
arm_3R 7390506..7390536 17..47 100   Minus

BO15778.pep Sequence

Translation from 16 to 385

> BO15778.pep
MCSLPHHSSFGVGLVTRKMGNSLSPTVEVTLEGDTYTLTTTSTFKTSAIS
FKLGVEFDEETLDGRNVKSIITLDGNKLTQEQKGDKPTTIVREFTDNELI
TTLTIGNVKCVRVYKAVASFLDH

BO15778.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 20:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
fabp-PA 117 CG6783-PA 1..117 1..117 595 100 Plus
fabp-PB 130 CG6783-PB 24..130 11..117 536 100 Plus
fabp-PC 157 CG6783-PC 24..116 11..103 456 97.8 Plus