Clone BO15847 Report

Search the DGRC for BO15847

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:158
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptTim10-RA
Protein status:BO15847.pep: validated full length
Sequenced Size:310

Clone Sequence Records

BO15847.3prime Sequence

308 bp (308 high quality bases) assembled on 2006-06-02

> BO15847.3prime
ATGGTCTAGAAAGCTTGCACTAGACATCTTCTTCATCAGCTCCTCGTCCT
GCATGGACATGGCCGTCAGCTTCTTGCCGATCTTCTCGTGAATGTCCAGA
TATTTGGCCACACAGCGATCGATGCACACCATCTCGCCTTTGCCCAACTC
CGACTCGGAGTAGCGCGGCGGAATGCACTTTTTGTGGCAAGCGTTCGTCA
TGCGGTTATATAAATCGGACATCATTTCGATCTCCATTTCCTGCATCAGC
TGCAGCTTGGCCTGGTCTGCGGTGCTGATCTGGGGCAATGCCATGTCGAC
TGATAACT

BO15847.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG9878-PB 279 Tim10-RB 1..276 294..19 1380 100 Minus
CG9878-PA 279 Tim10-RA 1..276 294..19 1380 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 691 CG9878-RA 281..556 294..19 1380 100 Minus
Tim10-RB 762 CG9878-RB 352..627 294..19 1380 100 Minus
CG42497-RA 691 CG42497-RA 281..556 294..19 1380 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-03 07:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21690788 143..294 760 100 Plus
2R 25286936 2R 21690350..21690475 19..144 630 100 Plus
Blast to na_te.dros performed 2015-02-03 07:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 212..267 138 73.7 Plus

BO15847.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:54:57 Download gff for BO15847.3prime
Subject Subject Range Query Range Percent Splice Strand
Tim10-PB 1..279 15..294 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:07 Download gff for BO15847.3prime
Subject Subject Range Query Range Percent Splice Strand
CG9878-PA 1..279 15..294 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-09 04:36:59 Download gff for BO15847.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 12..302 97   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-03 07:43:08 Download gff for BO15847.3prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 12..302 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-03 07:43:08 Download gff for BO15847.3prime
Subject Subject Range Query Range Percent Splice Strand
2R 21690344..21690474 12..143 97 <- Plus
2R 21690638..21690792 144..302 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-09 04:36:59 Download gff for BO15847.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577849..17577979 12..143 97 <- Plus
arm_2R 17578143..17578297 144..302 97   Plus

BO15847.5prime Sequence

308 bp (308 high quality bases) assembled on 2006-05-30

> BO15847.5prime
GAAGTTATCAGTCGACATGGCATTGCCCCAGATCAGCACCGCAGACCAGG
CCAAGCTGCAGCTGATGCAGGAAATGGAGATCGAAATGATGTCCGATTTA
TATAACCGCATGACGAACGCTTGCCACAAAAAGTGCATTCCGCCGCGCTA
CTCCGAGTCGGAGTTGGGCAAAGGCGAGATGGTGTGCATCGATCGCTGTG
TGGCCAAATATCTGGACATTCACGAGAAGATCGGCAAGAAGCTGACGGCC
ATGTCCATGCAGGACGAGGAGCTGATGAAGAAGATGTCTAGTGCAAGCTT
TCTAGACC

BO15847.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG9878-PB 279 Tim10-RB 1..276 17..292 1380 100 Plus
CG9878-PA 279 Tim10-RA 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-12 23:35:38
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 691 CG9878-RA 281..556 17..292 1380 100 Plus
Tim10-RB 762 CG9878-RB 352..627 17..292 1380 100 Plus
CG42497-RA 691 CG42497-RA 281..556 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-12 23:35:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21690788 168..17 760 100 Minus
2R 25286936 2R 21690350..21690475 292..167 630 100 Minus
Blast to na_te.dros performed 2015-02-12 23:35:36
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 99..44 138 73.7 Minus

BO15847.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:54:58 Download gff for BO15847.5prime
Subject Subject Range Query Range Percent Splice Strand
Tim10-PB 1..279 17..296 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:08 Download gff for BO15847.5prime
Subject Subject Range Query Range Percent Splice Strand
CG9878-PA 1..279 17..296 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-31 16:54:03 Download gff for BO15847.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 9..299 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 02:30:09 Download gff for BO15847.5prime
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 275..562 9..299 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 02:30:09 Download gff for BO15847.5prime
Subject Subject Range Query Range Percent Splice Strand
2R 21690344..21690474 168..299 97 <- Minus
2R 21690638..21690792 9..167 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-31 16:54:03 Download gff for BO15847.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577849..17577979 168..299 97 <- Minus
arm_2R 17578143..17578297 9..167 97   Minus

BO15847.complete Sequence

310 bp (310 high quality bases) assembled on 2006-08-24

GenBank Submission: FJ633605

> BO15847.complete
GAAGTTATCAGTCGACATGGCATTGCCCCAGATCAGCACCGCAGACCAGG
CCAAGCTGCAGCTGATGCAGGAAATGGAGATCGAAATGATGTCCGATTTA
TATAACCGCATGACGAACGCTTGCCACAAAAAGTGCATTCCGCCGCGCTA
CTCCGAGTCGGAGTTGGGCAAAGGCGAGATGGTGTGCATCGATCGCTGTG
TGGCCAAATATCTGGACATTCACGAGAAGATCGGCAAGAAGCTGACGGCC
ATGTCCATGCAGGACGAGGAGCTGATGAAGAAGATGTCTAGTGCAAGCTT
TCTAGACCAT

BO15847.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 14:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 279 CG9878-PA 1..276 17..292 1380 100 Plus
Tim10-RB 279 CG9878-PB 1..276 17..292 1380 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 14:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-RA 691 CG9878-RA 281..556 17..292 1380 100 Plus
Tim10-RB 762 CG9878-RB 352..627 17..292 1380 100 Plus
CG42497-RA 691 CG42497-RA 281..556 17..292 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 14:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21690637..21690788 168..17 760 100 Minus
2R 25286936 2R 21690350..21690475 292..167 630 100 Minus
Blast to na_te.dros performed 2014-11-26 14:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy4 6852 gypsy4 GYPSY4 6852bp 6386..6442 99..44 138 73.7 Minus

BO15847.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 22:59:45 Download gff for BO15847.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RA 1..279 17..296 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:31:48 Download gff for BO15847.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 271..558 9..299 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:43:26 Download gff for BO15847.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 281..556 17..294 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 22:59:45 Download gff for BO15847.complete
Subject Subject Range Query Range Percent Splice Strand
Tim10-RB 271..558 9..299 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:00:54 Download gff for BO15847.complete
Subject Subject Range Query Range Percent Splice Strand
CG42497-RA 281..556 17..294 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:00:54 Download gff for BO15847.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21690348..21690474 168..294 98 <- Minus
2R 21690638..21690788 17..167 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:43:26 Download gff for BO15847.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17577853..17577979 168..294 98 <- Minus
arm_2R 17578143..17578293 17..167 100   Minus

BO15847.pep Sequence

Translation from 16 to 310

> BO15847.pep
MALPQISTADQAKLQLMQEMEIEMMSDLYNRMTNACHKKCIPPRYSESEL
GKGEMVCIDRCVAKYLDIHEKIGKKLTAMSMQDEELMKKMSSASFLDH

BO15847.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 18:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
Tim10-PA 92 CG9878-PA 1..92 1..92 475 100 Plus
Tim10-PB 92 CG9878-PB 1..92 1..92 475 100 Plus