Clone BO15849 Report

Search the DGRC for BO15849

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:158
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG13631-RA
Protein status:BO15849.pep:
Sequenced Size:283

Clone Sequence Records

BO15849.3prime Sequence

281 bp (281 high quality bases) assembled on 2006-06-02

> BO15849.3prime
ATGGTCTAGAAAGCTTGCGTTGCGCCTCTCGCCCGCTCGTGCCGCCTGCC
GCTGCTGCTGTTGCTGCTGCTCCTTGTCGCGCAGCTCCTTGATGGCGCCC
ACCGTACCGAACATCACCTTGGCCGTCAGCTGGGCGCGGGGCGGACCGCC
GGACTTGCCGCTGGTGGCCGCCTCGCGGTCCAGAGATGCATTCGCATTGG
CGTAGGCGTTGGTGTACGAGACGTAGTTGTTGTTGAGGTCGCGACCGCAG
CTGCACTGATGCGACATGTCGACTGATAACT

BO15849.3prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PA 252 CG13631-RA 1..249 267..19 1245 100 Minus
CG31247-PD 4542 tinc-RD 3188..3215 71..44 140 100 Minus
CG31247-PA 4542 tinc-RA 3188..3215 71..44 140 100 Minus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-04 10:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 1583 CG13631-RB 170..420 269..19 1255 100 Minus
CG13631-RA 761 CG13631-RA 170..420 269..19 1255 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2015-02-04 10:23:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24769520..24769770 269..19 1255 100 Minus
Blast to na_te.dros performed on 2015-02-04 10:23:04 has no hits.

BO15849.3prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:01 Download gff for BO15849.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 1..252 16..267 99   Minus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:12 Download gff for BO15849.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 1..252 16..267 99   Minus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-10 11:25:12 Download gff for BO15849.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 160..420 19..277 98   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-04 12:36:25 Download gff for BO15849.3prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 160..420 19..277 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-04 12:36:25 Download gff for BO15849.3prime
Subject Subject Range Query Range Percent Splice Strand
3R 24769510..24769770 19..277 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-10 11:25:12 Download gff for BO15849.3prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20595232..20595492 19..277 98   Minus

BO15849.5prime Sequence

281 bp (281 high quality bases) assembled on 2006-05-30

> BO15849.5prime
GAAGTTATCAGTCGACATGTCGCATCAGTGCAGCTGCGGTCGCGACCTCA
ACAACAACTACGTCTCGTACACCAACGCCTACGCCAATGCGAATGCATCT
CTGGACCGCGAGGCGGCCACCAGCGGCAAGTCCGGCGGTCCGCCCCGCGC
CCAGCTGACGGCCAAGGTGATGTTCGGTACGGTGGGCGCCATCAAGGAGC
TGCGCGACAAGGAGCAGCAGCAACAGCAGCAGCGGCAGGCGGCACGAGCG
GGCGAGAGGCGCAACGCAAGCTTTCTAGACC

BO15849.5prime Blast Records

Blast to dmel-all-CDS-r5.1.fasta performed 2007-05-06 15:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PA 252 CG13631-RA 1..249 17..265 1245 100 Plus
CG31247-PD 4542 tinc-RD 3188..3215 213..240 140 100 Plus
CG31247-PA 4542 tinc-RA 3188..3215 213..240 140 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2015-02-13 09:09:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 1583 CG13631-RB 170..420 15..265 1255 100 Plus
CG13631-RA 761 CG13631-RA 170..420 15..265 1255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2015-02-13 09:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24769520..24769770 15..265 1255 100 Plus
Blast to na_te.dros performed on 2015-02-13 09:09:06 has no hits.

BO15849.5prime Sim4 Records

Sim4 to dmel-all-CDS-r4.3.fasta performed 2007-01-18 06:55:02 Download gff for BO15849.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 1..252 17..268 99   Plus
Sim4 to dmel-all-CDS-r5.1.fasta performed 2007-05-10 07:00:14 Download gff for BO15849.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-PA 1..252 17..268 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-02 09:27:54 Download gff for BO15849.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 160..420 7..265 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2015-02-13 12:58:01 Download gff for BO15849.5prime
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 160..420 7..265 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2015-02-13 12:58:01 Download gff for BO15849.5prime
Subject Subject Range Query Range Percent Splice Strand
3R 24769510..24769770 7..265 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-02 09:27:54 Download gff for BO15849.5prime
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20595232..20595492 7..265 98   Plus

BO15849.complete Sequence

283 bp (283 high quality bases) assembled on 2006-08-25

GenBank Submission: FJ633606

> BO15849.complete
GAAGTTATCAGTCGACATGTCGCATCAGTGCAGCTGCGGTCGCGACCTCA
ACAACAACTACGTCTCGTACACCAACGCCTACGCCAATGCGAATGCATCT
CTGGACCGCGAGGCGGCCACCAGCGGCAAGTCCGGCGGTCCGCCCCGCGC
CCAGCTGACGGCCAAGGTGATGTTCGGTACGGTGGGCGCCATCAAGGAGC
TGCGCGACAAGGAGCAGCAGCAACAGCAGCAGCGGCAGGCGGCACGAGCG
GGCGAGAGGCGCAACGCAAGCTTTCTAGACCAT

BO15849.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:09:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 252 CG13631-PB 1..249 17..265 1245 100 Plus
CG13631-RA 252 CG13631-PA 1..249 17..265 1245 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:09:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-RB 1583 CG13631-RB 170..420 15..265 1255 100 Plus
CG13631-RA 761 CG13631-RA 170..420 15..265 1255 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24769520..24769770 15..265 1255 100 Plus
Blast to na_te.dros performed on 2014-11-27 20:09:47 has no hits.

BO15849.complete Sim4 Records

Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 22:59:39 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:06:50 Download gff for BO15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 158..418 7..265 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:07:27 Download gff for BO15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 172..420 17..267 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed on 2008-07-21 22:59:39 has no hits.
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:16:09 Download gff for BO15849.complete
Subject Subject Range Query Range Percent Splice Strand
CG13631-RA 172..420 17..267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:16:09 Download gff for BO15849.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24769522..24769770 17..267 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:07:27 Download gff for BO15849.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20595244..20595492 17..267 99   Plus

BO15849.pep Sequence

Translation from 16 to 283

> BO15849.pep
MSHQCSCGRDLNNNYVSYTNAYANANASLDREAATSGKSGGPPRAQLTAK
VMFGTVGAIKELRDKEQQQQQQRQAARAGERRNASFLDH

BO15849.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG13631-PB 83 CG13631-PB 1..83 1..83 428 100 Plus
CG13631-PA 83 CG13631-PA 1..83 1..83 428 100 Plus